[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68811.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   55->149 3bl4B PDBj 2e-08 8.7 %
:HMM:SCOP  5->161 1eysH1 b.41.1.1 * 1e-13 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68811.1 GT:GENE BAC68811.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1386020..1386520) GB:FROM 1386020 GB:TO 1386520 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05239: PRC-barrel domain GB:PROTEIN_ID BAC68811.1 LENGTH 166 SQ:AASEQ MQDVRNGVLSWRGRPLRPRGGERWPARTARSPGLAARLLGREGNGVSIDGPWFYEPATGHMEGQDLTGFTVEATDGTIGQVDRQADDVGMRHLVVDTGVWVFGKSVLIPVGVITGIDTQARQITLACTKEEVKAAPLFRTDSETLDPEYLGSVGAYYRELPRDRTE GT:EXON 1|1-166:0| SEG 12->25|rgrplrprggerwp| RP:PDB:NREP 1 RP:PDB:REP 55->149|3bl4B|2e-08|8.7|92/109| HM:SCP:REP 5->161|1eysH1|1e-13|33.3|153/201|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 14 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11--2--4-2--------------------------------------------------------------------------------------------------12-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 55.4 SQ:SECSTR ######################################################EcTTccEEEEccccccccHHHHHHHHHHTTccccEEEcccHHHHHH##HHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccEE#EEccH################# DISOP:02AL 1-4, 159-166| PSIPRED cccHHccHHHccccccccccccccccccccccccEEEEEEcccccEEEcccccccccccccccccEEccEEEEcccccEEEEEEcccccEEEEEEEccccccccEEEEEEEEEEEccccccEEEEcccHHHHHcccccccccccccHHHHHHHHHHHccccccccc //