[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68813.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   47->160 2btzA PDBj 7e-07 20.0 %
:RPS:SCOP  55->108 1pvgA2  d.122.1.2 * 4e-06 13.2 %
:HMM:SCOP  25->155 1l0oA_ d.122.1.3 * 3.8e-10 23.3 %
:HMM:PFM   62->136 PF02518 * HATPase_c 4.8e-11 25.3 75/111  
:HMM:PFM   14->53 PF03454 * MoeA_C 0.00056 35.0 40/73  
:BLT:SWISS 63->100 SP2AB_PASPE 3e-04 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68813.1 GT:GENE BAC68813.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1387458..1387943) GB:FROM 1387458 GB:TO 1387943 GB:DIRECTION - GB:PRODUCT putative regulatory protein GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC68813.1 LENGTH 161 SQ:AASEQ MVISLWQQVSKEQAPGRHATPRCRVTWEGGTATAVEGRTASSNFLSEVQEADGTPLPDRLVGDIQLVVSELVTNAIRHAPGPCGLQVELSADGRAVRVAVWDTSSKMPTPRPRDACRIGGHGLEIVRAVSRSVIVQPGSPGKQVTAEIELPQPARGESASW GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 63->100|SP2AB_PASPE|3e-04|50.0|38/150| RP:PDB:NREP 1 RP:PDB:REP 47->160|2btzA|7e-07|20.0|110/357| HM:PFM:NREP 2 HM:PFM:REP 62->136|PF02518|4.8e-11|25.3|75/111|HATPase_c| HM:PFM:REP 14->53|PF03454|0.00056|35.0|40/73|MoeA_C| RP:SCP:NREP 1 RP:SCP:REP 55->108|1pvgA2|4e-06|13.2|53/239|d.122.1.2| HM:SCP:REP 25->155|1l0oA_|3.8e-10|23.3|129/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 16 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1--1----------------------563----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 70.8 SQ:SECSTR ##############################################EEEETTcTTcccEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEEccccccccHHHHHHHHcccHHHHHHHHHHEEEEEEEETTTEEEEEEEEEccTTTcccc# DISOP:02AL 9-23, 114-115, 153-161| PSIPRED cEEEccHHHccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcEEEEccccEEEEEEEEEcccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEccccccccccccc //