[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68817.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68817.1 GT:GENE BAC68817.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1393073..1393315) GB:FROM 1393073 GB:TO 1393315 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68817.1 LENGTH 80 SQ:AASEQ MVNVKGHAMSMDASELEAESAELLPGREALGRLKFSFGKTVNVTKHVANVSAHNESAALNDHSSWSVAQSQAAQSINITQ GT:EXON 1|1-80:0| SEG 13->24|aseleaesaell| SEG 63->75|sswsvaqsqaaqs| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccEEEEcHHHHcccccccccccHHHcEEEEccccEEEEHHHEEccccccccccccccccEEEcccccccEEEccc //