[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68819.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->73 PF04545 * Sigma70_r4 0.00078 30.8 26/50  
:HMM:PFM   16->40 PF09339 * HTH_IclR 1.3e-05 48.0 25/52  
:BLT:SWISS 19->50 SC24B_HUMAN 1e-04 50.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68819.1 GT:GENE BAC68819.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1393981..1394376 GB:FROM 1393981 GB:TO 1394376 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC68819.1 LENGTH 131 SQ:AASEQ MANALQQIIRDRLDSERWSYGEVARRGNIPRSTVHHLATTDHMARMPQPATLEGLALGLGLPLGAIRQAAAEACGIHLYAAGAEPPRAAGGTSADPDVEVLIASLQRLSSDDRRHVAALVESLLNRAPGTS GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 19->50|SC24B_HUMAN|1e-04|50.0|32/100| SEG 52->64|leglalglglplg| SEG 80->91|aagaeppraagg| HM:PFM:NREP 2 HM:PFM:REP 48->73|PF04545|0.00078|30.8|26/50|Sigma70_r4| HM:PFM:REP 16->40|PF09339|1.3e-05|48.0|25/52|HTH_IclR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 89-91, 128-131| PSIPRED ccHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHcEEEEEccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccc //