[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68820.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->89 1oxhA PDBj 9e-05 31.6 %
:HMM:PFM   31->58 PF03250 * Tropomodulin 0.00038 48.1 27/147  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68820.1 GT:GENE BAC68820.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1394582..1394878 GB:FROM 1394582 GB:TO 1394878 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68820.1 LENGTH 98 SQ:AASEQ MSRTPRVIWGEQLLFVHGGPTTAIVKGPTGESVVLLSGELPANLTDASIGELLDLAAAVLTEGELALFEQCLTTLRRGEGPTPQRIEVNGAVMTVYRD GT:EXON 1|1-98:0| BL:PDB:NREP 1 BL:PDB:REP 11->89|1oxhA|9e-05|31.6|79/408| HM:PFM:NREP 1 HM:PFM:REP 31->58|PF03250|0.00038|48.1|27/147|Tropomodulin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 80.6 SQ:SECSTR ##########GGccEEcccccHHHHHHHHHHHHHHHccccEEEcTHHHHcccGGGHHHHHHHHHHHHHHTTEEccccccccccTTcccE######### DISOP:02AL 1-3| PSIPRED ccccccEEEccEEEEEEccccEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEccEEEEEEEc //