[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68823.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.70.1
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  49->133 2r6gF1  e.70.1.1 * 9e-04 23.8 %
:HMM:PFM   115->169 PF05643 * DUF799 5.7e-05 37.7 53/215  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68823.1 GT:GENE BAC68823.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1397147..1397677) GB:FROM 1397147 GB:TO 1397677 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68823.1 LENGTH 176 SQ:AASEQ MREPNVIGDWQEYEDEYAGLRVRVHGLEEAEPPRGRDDAAEGLTYFRFRVTVENRASEPVDIHFEDGQLDIRTGPDGVSAFLDWRNSQFIEGFDLYPLRRATAVLYAAGADTSLTRVDIQIHLKADDEWTGRYLWSGDMSLPVGSAESGVRCEGAVESLVGQVSNFLREEAEQGPG GT:EXON 1|1-176:0| HM:PFM:NREP 1 HM:PFM:REP 115->169|PF05643|5.7e-05|37.7|53/215|DUF799| RP:SCP:NREP 1 RP:SCP:REP 49->133|2r6gF1|9e-04|23.8|63/246|e.70.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 29-37, 168-176| PSIPRED cccccccccHHHHHHHcccEEEEEEcccccccccccccccccEEEEEEEEEEEcccccEEEEEEEccEEEEEEcccccEEEEEcccccEEccccccccccEEEEEEEccccccEEEEEEEEEEEEcccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccc //