[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68826.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:579 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   62->260 PF02366 * PMT 2.7e-13 22.9 188/245  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68826.1 GT:GENE BAC68826.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1400293..1402032 GB:FROM 1400293 GB:TO 1402032 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase GB:PROTEIN_ID BAC68826.1 LENGTH 579 SQ:AASEQ MPAFMADSGEHTAVRDPIGPVPPASGEDDSRRPAGLGRRLRRYRRWLLVCAVAALLAQMAVAMITTAVEQTPTIDEPVYAGTAVVYVQQHSLRYNPEHPPLGKLIIATGMAVARPHLAPGFVGDQGELGRHLLYESGNDPWRVMFWARLPVIVVTLLLGLVVFAFARDLVGAVGGLAALALYAFSPDVVAHGSLATLDVPAAGFVLTAAWLVWRARRRPLPYLPLAGLATGAALATKMSTLPVVPVLMCLAGWSFWCARRTDGPEPRERARLAGRAAAVAAGVALVAVVVVWATYLVVDPRLRWTASGHVPTVHGLRGLLVEWLPFPEAYRDGMRVQFGFENATWHGFLFGRLYSGSLWYYLPAALIVKTPLGMLGLWLAGVGVMAAVPRLRAAAGYVVLPPAVLLAAAMTGSRDLGVRYALFMPVFLAVAAACVLALRRWWAHLAVAVLVGFVAVSSVRTFPLYLPYSNEAFGGPAETHLRLHDSNVDWGQDLGRLADRLRQRYPGEKVWLVYKGSGVPAAYGITASDPRKVAPGRVHGLLVVSDSSIAKAEGRFARLIDSSEAIDEVGHSITVFRRK GT:EXON 1|1-579:0| TM:NTM 9 TM:REGION 46->68| TM:REGION 153->175| TM:REGION 193->214| TM:REGION 228->250| TM:REGION 276->298| TM:REGION 364->386| TM:REGION 392->414| TM:REGION 417->438| TM:REGION 441->463| SEG 31->62|rrpaglgrrlrryrrwllvcavaallaqmava| SEG 149->162|lpvivvtlllglvv| SEG 169->181|lvgavgglaalal| SEG 214->236|rarrrplpylplaglatgaalat| SEG 270->291|arlagraaavaagvalvavvvv| SEG 393->409|aaagyvvlppavllaaa| SEG 429->459|avaaacvlalrrwwahlavavlvgfvavssv| HM:PFM:NREP 1 HM:PFM:REP 62->260|PF02366|2.7e-13|22.9|188/245|PMT| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- 1-1----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 21-35, 263-270| PSIPRED ccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccEEEEEcEEEEEccccccHHHHHHHHHHHHHcccccccccccccHHHHHHcccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccHHHHcccEEEEEcccccEEHEEEEHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEccccccccccccccEEEEEEEccccHHHHccHHHHHHccHHHHHHcccEEEEEEcc //