Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68828.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68828.1 GT:GENE BAC68828.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1403619..1403963 GB:FROM 1403619 GB:TO 1403963 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68828.1 LENGTH 114 SQ:AASEQ MAQPPAAERAAGAGIPAPSILVLSPFASCVVQLVRHEPFTLDRRVRHFVGFPHLTHFVYCTGFGELGLLVRARPVRFRTAHRYAEPDGPDQSAGDHQTANKSGKHVEYITRRGQ GT:EXON 1|1-114:0| SEG 2->18|aqppaaeraagagipap| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 84-102, 113-114| PSIPRED ccccccccHHccccccccHHHEEcHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHccccccccEEEccccHHHHHHHcccccccccccccccccccccccHHHHHcccc //