[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68831.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->69 3hhgG PDBj 2e-04 44.4 %
:BLT:PDB   96->277 3fd3A PDBj 9e-30 43.1 %
:RPS:PDB   5->114 1b9nA PDBj 2e-14 10.9 %
:RPS:PDB   90->265 3e4rA PDBj 1e-07 9.2 %
:RPS:SCOP  1->107 1b9mA1  a.4.5.8 * 5e-13 11.2 %
:RPS:SCOP  95->269 1i69A  c.94.1.1 * 6e-07 18.8 %
:HMM:SCOP  5->115 1b9mA1 a.4.5.8 * 8.9e-21 42.3 %
:HMM:SCOP  86->298 1uthA_ c.94.1.1 * 6.7e-24 28.5 %
:RPS:PFM   10->65 PF00126 * HTH_1 1e-06 44.6 %
:HMM:PFM   92->297 PF03466 * LysR_substrate 2.5e-20 27.5 200/209  
:HMM:PFM   7->65 PF00126 * HTH_1 3.1e-20 40.7 59/60  
:BLT:SWISS 13->284 Y2007_MYCBO 2e-52 45.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68831.1 GT:GENE BAC68831.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1406456..1407412 GB:FROM 1406456 GB:TO 1407412 GB:DIRECTION + GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF00126: Bacterial regulatory helix-turn-helix protein, lysR family GB:PROTEIN_ID BAC68831.1 LENGTH 318 SQ:AASEQ MMAELPLDLVRTLLAVVDEGTFDAAASALHVTPSAVSQRVKALERRTGRVLLMRTKPVRPTESGEAVVRFARRLARLELDARAELGMTGSEEPTRLSIAVNSDSLATWFLPALARVPEELRLSYELRREDQDHTAALLREGLVMAAVTSSPDPVTGCSVQSLGRMRYMAVAGPGFAARWLGDRPDVPLRQVLADAPVVCFDRRDDLQDGFVRGLRRGRGGASALRHFVPTSEGFVDAVAAGMGWGMVPQVQAEPLLRAGRLVHLATDRPIDVPLYWQQWKLDSPALSAVAEAVASAAAAALDGGSQWPHVTSAVTGRG GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 13->284|Y2007_MYCBO|2e-52|45.6|263/303| SEG 71->85|arrlarleldarael| SEG 118->129|eelrlsyelrre| SEG 212->220|rglrrgrgg| SEG 285->301|alsavaeavasaaaaal| BL:PDB:NREP 2 BL:PDB:REP 16->69|3hhgG|2e-04|44.4|54/294| BL:PDB:REP 96->277|3fd3A|9e-30|43.1|174/202| RP:PDB:NREP 2 RP:PDB:REP 5->114|1b9nA|2e-14|10.9|110/258| RP:PDB:REP 90->265|3e4rA|1e-07|9.2|174/291| RP:PFM:NREP 1 RP:PFM:REP 10->65|PF00126|1e-06|44.6|56/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 92->297|PF03466|2.5e-20|27.5|200/209|LysR_substrate| HM:PFM:REP 7->65|PF00126|3.1e-20|40.7|59/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->107|1b9mA1|5e-13|11.2|107/122|a.4.5.8| RP:SCP:REP 95->269|1i69A|6e-07|18.8|160/206|c.94.1.1| HM:SCP:REP 5->115|1b9mA1|8.9e-21|42.3|104/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 86->298|1uthA_|6.7e-24|28.5|207/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 335 OP:NHOMOORG 281 OP:PATTERN -------------------------------------------------------------------- ----1111111---1--1--11---111111-11111111----11-111--111-21--1-1-1--111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-------1-----21111111111-1-1--1-11111-11--------111----1----------------------------------1111112333332222222252222-2343-1-1--11-31222122211--1----11--------------11---11--1111---------------------------------------------11111-1---111111-1111111111111----1--------11111111111112111-1111111111111111111111221111111111111111111111111111-111111111111---------------121------------1--1111111-----11111111112112111---1--1------111111111112211111------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 87.1 SQ:SECSTR cccHEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEcccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHHHHTcccTTccEEEHccccccccccTTccccccHHHHTcccEEcHHHHHcHHHHTTccccccGGGGGGcHHHHHTTEEHccTTcEEEEccEccEEEETTEEEEEEEEGGHHHHHHHHTTccGGGcEEccHHHHHHHHHTTcccEEEEETTHHHHHHHTTcEEEEEcTTcccEEEEEE######################################### DISOP:02AL 1-2, 85-92, 314-318| PSIPRED ccccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHccEEEEEEEccccccccEEEEEEccccEEEEEcHHHHHHccccccccccHHHHHcccEEEEccccccHHHHHHHccccccEEcccEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHccccc //