[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68834.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.6
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   39->245 3c8cA PDBj 5e-12 14.6 %
:RPS:SCOP  40->204 2p7jA2  d.110.6.2 * 3e-06 13.8 %
:HMM:PFM   166->227 PF02743 * Cache_1 1.1e-06 26.2 61/80  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68834.1 GT:GENE BAC68834.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1410593..1411429) GB:FROM 1410593 GB:TO 1411429 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF02743: Cache domain GB:PROTEIN_ID BAC68834.1 LENGTH 278 SQ:AASEQ MPHSIPQPGLSFCLAAHPVPAPAGSGRPATATLDVSPQARVAAQVRSALEAVFEAVEETRADTAALLAQVAGLGRRPATVDLAGLRPGLHLRLARQELVSGVGFVAAPGLLGDVPTWLEWWQTGADGALRPLLLDLDPRQSAYSDYTHWDWFALPRDTGRRAVAGPYVDYLCSEEYSLTLSAPVQVEGRFAGVAAADVYLRHFETAVMPLLQRLPGPAHLVNARGRVAASADPAHLAGSLTKGPDFAAVLTQARPEHFDGLHLMPCDGVPLVLVMAER GT:EXON 1|1-278:0| SEG 124->139|gadgalrpllldldpr| RP:PDB:NREP 1 RP:PDB:REP 39->245|3c8cA|5e-12|14.6|185/238| HM:PFM:NREP 1 HM:PFM:REP 166->227|PF02743|1.1e-06|26.2|61/80|Cache_1| RP:SCP:NREP 1 RP:SCP:REP 40->204|2p7jA2|3e-06|13.8|152/172|d.110.6.2| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------1------1----------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 78.8 SQ:SECSTR #####################################THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcHHHHHHHHccHHHHHHcccEEEEETTTccEEEccTTccEEEEETTccEEEETTTTcTTccccccGGGcHHHHHHHHHTccEEcccEEcTTTccEEEEEEEEEcTTTccEEEEEEEEEcHHHHHHHHTccccTTcEEEEEEETTccEEEcccGGGTTccHHHHccHHHHHHHTTTT###################### DISOP:02AL 1-5, 69-83| PSIPRED cccccccccHHEEEEEcccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHEEEEEEEEccccccccEEEEcccccccccccEEEEcccccccccccccccHHHHHHHHccccEEEccccccccccEEEEEEEEEEEEccEEEEEEEEEccHHHHHHHHHHcccccccEEEEEEcccEEEEEccHHHHcccccccHHHHHHcccccccccccEEEEEEccccEEEEEEcc //