[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68837.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  42/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.67.3b.82.5d.65.1
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->187 1s18A  b.67.3.1 * 9e-27 11.4 %
:RPS:SCOP  174->215 1tzpA  d.65.1.3 * 8e-12 28.6 %
:HMM:SCOP  27->217 1yoxA1 b.82.5.2 * 2.9e-40 34.4 %
:RPS:PFM   38->213 PF01987 * DUF124 1e-10 33.5 %
:HMM:PFM   29->216 PF01987 * DUF124 3.6e-46 26.3 186/215  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68837.1 GT:GENE BAC68837.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1414635..1415312 GB:FROM 1414635 GB:TO 1415312 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01987: Protein of unknown function DUF124 GB:PROTEIN_ID BAC68837.1 LENGTH 225 SQ:AASEQ MKGDLFSSDHMVEPAVAPGMTVQNAKSIKYAVNGDMLARQGAMIAYRGNLQFERKGQGVGGMLKRAVTGEGLPLMTVRGQGEAWFAHEAQNCFVVGIEPGDVFTVNGRNVLCFDSTLTYEIKTVKGAGISGGGLFNSVFTGHGKLGLICEGNPLVIPVSQQQPVYVDTDAVVGWTAHLHTSLHRSQSIGSMLRGGSGEAVQLKLEGDGYVVVRPSEATPQKVQQH GT:EXON 1|1-225:0| RP:PFM:NREP 1 RP:PFM:REP 38->213|PF01987|1e-10|33.5|173/209|DUF124| HM:PFM:NREP 1 HM:PFM:REP 29->216|PF01987|3.6e-46|26.3|186/215|DUF124| RP:SCP:NREP 2 RP:SCP:REP 21->187|1s18A|9e-27|11.4|166/317|b.67.3.1| RP:SCP:REP 174->215|1tzpA|8e-12|28.6|42/240|d.65.1.3| HM:SCP:REP 27->217|1yoxA1|2.9e-40|34.4|189/0|b.82.5.2|1/1|TRAP-like| OP:NHOMO 84 OP:NHOMOORG 53 OP:PATTERN ------------------------111-111------------------11-11-------------- --------------1------1---1------11112222-4442-11--------------1-1--6661-----------1--------------------------------------------------------------------------------------1-------------111-------------------------112-------1---------------------------------------------------------------------------------------------------------------------1--1----1---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------ -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 56-60, 221-225| PSIPRED cccccccccccccccccccEEEcccEEEEEEccccEEEEEccEEEEcccEEEEEcccHHHHHHHHHHccccEEEEEEEEccEEEEccccccEEEEEEccccEEEEEcccEEEEccccEEEEEEEEEEEEEccEEEEEEEEEcEEEEEEccccEEEEEcccccEEEEcccEEEEEEccccEEEEEEEEEEEEEEccccEEEEEEEEccEEEEEEEccccHHHHHcc //