[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68845.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  10->108 1v70A_ b.82.1.9 * 3.8e-05 23.2 %
:HMM:PFM   117->152 PF01907 * Ribosomal_L37e 5.6e-05 30.6 36/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68845.1 GT:GENE BAC68845.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1424120..1424587 GB:FROM 1424120 GB:TO 1424587 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07883: Cupin domain GB:PROTEIN_ID BAC68845.1 LENGTH 155 SQ:AASEQ MTHPPAGPVLAALVSRATGGRYWRLDRPGAGLDAEAMHIPPGAAAEPPGDRSRDVLVIALDGGGRLRTPGGWLELAPPAAVWLPPAAGYRLHAGEAGLHCVTVRPRRPAAPPALPTTGATGEPACLLHQVCAECGRMATESDARYCNRCGNPLER GT:EXON 1|1-155:0| SEG 73->87|lelappaavwlppaa| SEG 104->124|rprrpaappalpttgatgepa| HM:PFM:NREP 1 HM:PFM:REP 117->152|PF01907|5.6e-05|30.6|36/55|Ribosomal_L37e| HM:SCP:REP 10->108|1v70A_|3.8e-05|23.2|99/0|b.82.1.9|1/1|RmlC-like cupins| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 153-155| PSIPRED ccccccHHHHHHHHHHccccEEEEEccccccccccEEEccccccccccccccccEEEEEEccccEEEcccccEEEccccEEEEcccccEEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHccccccc //