[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68849.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->158 3cdhB PDBj 3e-13 23.9 %
:RPS:SCOP  28->156 3broA1  a.4.5.28 * 3e-10 12.6 %
:HMM:SCOP  15->159 2fbkA1 a.4.5.28 * 6.6e-13 21.1 %
:BLT:SWISS 50->157 SLYA_KLEP3 2e-04 23.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68849.1 GT:GENE BAC68849.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1427146..1427637 GB:FROM 1427146 GB:TO 1427637 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68849.1 LENGTH 163 SQ:AASEQ MKPLTGSTTDQAPADPAATDDVLATQPIGYWSGLAHTAVTRQLRDAMARIDVTQPQYWVLNRVHGGPAAPGREEVVTQLTPLADGPHEIARVVDQLLHRGWLRIDAGQRLRLTDTGEAARKRLRELVTELRAVVHEGISDEEYVTALKVLRTMIANVEGDAGC GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 50->157|SLYA_KLEP3|2e-04|23.8|105/144| SEG 8->25|ttdqapadpaatddvlat| RP:PDB:NREP 1 RP:PDB:REP 42->158|3cdhB|3e-13|23.9|109/131| RP:SCP:NREP 1 RP:SCP:REP 28->156|3broA1|3e-10|12.6|127/135|a.4.5.28| HM:SCP:REP 15->159|2fbkA1|6.6e-13|21.1|142/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1--------------1-----------1--1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 84.0 SQ:SECSTR #########################ccHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHcccHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHTcEEEcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHTcGGGGHHHHHHHHHHHTcHHcc# DISOP:02AL 1-8, 162-163| PSIPRED cccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccc //