[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68855.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  235/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->158 1u69A PDBj 2e-29 43.9 %
:RPS:SCOP  7->158 1u69A  d.32.1.7 * 9e-48 42.1 %
:HMM:SCOP  4->158 1u69A_ d.32.1.7 * 9.1e-57 49.7 %
:RPS:PFM   7->118 PF06983 * 3-dmu-9_3-mt 3e-25 47.3 %
:HMM:PFM   6->119 PF06983 * 3-dmu-9_3-mt 4.6e-53 60.5 114/116  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68855.1 GT:GENE BAC68855.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1434873..1435355) GB:FROM 1434873 GB:TO 1435355 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF06983: 3-demethylubiquinone-9 3-methyltransferase GB:PROTEIN_ID BAC68855.1 LENGTH 160 SQ:AASEQ MPAEGFTTCLWFDGQAEEAADYYVSVFKNSRLGRVGRYPEGGPGPAGSVMVVEFVANGQKFVALNGGPQFTFSEAVSFQIFCDDQDEVDHYWNRLTEGGGEGGPCGWLKDRYGLSWQVVPAKLIGMIGDADPEKAARTSKAMMEMGKLDIAALEKAYEGE GT:EXON 1|1-160:0| SEG 97->103|egggegg| BL:PDB:NREP 1 BL:PDB:REP 7->158|1u69A|2e-29|43.9|148/152| RP:PFM:NREP 1 RP:PFM:REP 7->118|PF06983|3e-25|47.3|112/126|3-dmu-9_3-mt| HM:PFM:NREP 1 HM:PFM:REP 6->119|PF06983|4.6e-53|60.5|114/116|3-dmu-9_3-mt| RP:SCP:NREP 1 RP:SCP:REP 7->158|1u69A|9e-48|42.1|152/156|d.32.1.7| HM:SCP:REP 4->158|1u69A_|9.1e-57|49.7|155/0|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 320 OP:NHOMOORG 266 OP:PATTERN --------------------------------------------1-------1--------------- 131-----111---111----1--11-----111112111-111--1-111---1-----------1111-----------------------------1-----1-1-2------------------1----------1-----------------------------1----------------------1-11111111-111111------111----1-1------1-111111111111111-11111----------------------111-----------------------------------11---111--1-1-----------------------------121--------------1--2--1-----112112111--11----------1-11111511212-311-322341131--1---11111-------------------------------------------------1121--11-12222221222211112222112211111--11111-1111312-11-1------------21111-1--------------1-11111--111111---------------------------11--------------------------------------------------------------------------------------------------------1-------------------------------111--1-----------------------------22221111-11111---------------------------11----------------111122-----------------------------------------------1- --------------------11-----1111111111111111111----111111-1-------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 93.1 SQ:SECSTR ######cEEEEEcccHHHHHHHHHHHcTTEEEEEEEEcccccTccTTcEEEEEEEETTEEEEEEEccTTccccTTcEEEEEEccHHHHHHHHHHHHHTTcEEccTTEEEcTTccEEEEEEHHHHHHH##TcccHHH#HHHHHHHTccccHHHHHHHHc## DISOP:02AL 1-2, 159-160| PSIPRED cccccccEEEEEcccHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEEEccEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHccccEEccccEEEcccccEEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHccc //