[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68858.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->97 3f52E PDBj 7e-09 54.3 %
:RPS:PDB   59->97 2ecsA PDBj 1e-04 5.1 %
:RPS:SCOP  59->95 1lliA  a.35.1.2 * 4e-04 10.8 %
:HMM:SCOP  58->124 1b0nA2 a.35.1.3 * 2.5e-10 31.3 %
:HMM:PFM   63->117 PF01381 * HTH_3 9e-13 29.1 55/55  
:HMM:PFM   99->147 PF10728 * DUF2520 0.00068 28.6 49/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68858.1 GT:GENE BAC68858.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1437000..1437455) GB:FROM 1437000 GB:TO 1437455 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC68858.1 LENGTH 151 SQ:AASEQ MSNQAPNEARVIALRPASAPPRSPNAARVPVTAPGRAPQRPGQRPAAPAAKEPLWRDLVGDVLRRERLAQERTLKDVADAARISMPYLSELERGRKEASSEVLAAAAQALGLGLTDLLSLAHHELTRHTRTRPARGRTAPTARYDGMCLAA GT:EXON 1|1-151:0| SEG 13->31|alrpasapprspnaarvpv| SEG 33->50|apgrapqrpgqrpaapaa| SEG 98->121|assevlaaaaqalglgltdllsla| SEG 126->143|trhtrtrpargrtaptar| BL:PDB:NREP 1 BL:PDB:REP 52->97|3f52E|7e-09|54.3|46/78| RP:PDB:NREP 1 RP:PDB:REP 59->97|2ecsA|1e-04|5.1|39/60| HM:PFM:NREP 2 HM:PFM:REP 63->117|PF01381|9e-13|29.1|55/55|HTH_3| HM:PFM:REP 99->147|PF10728|0.00068|28.6|49/132|DUF2520| RP:SCP:NREP 1 RP:SCP:REP 59->95|1lliA|4e-04|10.8|37/89|a.35.1.2| HM:SCP:REP 58->124|1b0nA2|2.5e-10|31.3|67/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ---------------1111-11--1111111111111111----------------------1---11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 30.5 SQ:SECSTR ###################################################cccHHHHccEEEEHHHHHHHHcHHHHHHHHTccHHHHHHHHHTTcc###################################################### DISOP:02AL 1-6, 17-55, 130-135| PSIPRED cccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHcccccccccccccEEEEcc //