[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68860.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->54 PF00668 * Condensation 6.4e-05 23.4 47/301  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68860.1 GT:GENE BAC68860.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1439316..1439543 GB:FROM 1439316 GB:TO 1439543 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68860.1 LENGTH 75 SQ:AASEQ MLMAHPAVLRNLVEQYETLRALHAENGSTEVRQRMDDAAYTLCVSTGTKDVEAALVAARRRLPLARTKEDSLLTT GT:EXON 1|1-75:0| SEG 53->66|aalvaarrrlplar| HM:PFM:NREP 1 HM:PFM:REP 8->54|PF00668|6.4e-05|23.4|47/301|Condensation| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 25-32| PSIPRED cccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccc //