[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68863.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   51->145 3ehjA PDBj 8e-05 20.0 %
:HMM:PFM   63->142 PF02518 * HATPase_c 1.8e-06 27.5 80/111  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68863.1 GT:GENE BAC68863.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1442225..1442683) GB:FROM 1442225 GB:TO 1442683 GB:DIRECTION - GB:PRODUCT putative regulatory protein GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC68863.1 LENGTH 152 SQ:AASEQ MIESLDGAVIPTDFDMPVEPLRRAAHYTGELGSIAEARAFAALFLEQLRSEWCAPIDARADGDLLLVVSELVTNADRHSHGPYILELEGTDASVTVTVYDSSAALPRRYPPDPGRVGMHGLEIVHVLAAAVTVERVPVGKCVRAVMELPKQS GT:EXON 1|1-152:0| SEG 35->49|aearafaalfleqlr| RP:PDB:NREP 1 RP:PDB:REP 51->145|3ehjA|8e-05|20.0|90/196| HM:PFM:NREP 1 HM:PFM:REP 63->142|PF02518|1.8e-06|27.5|80/111|HATPase_c| OP:NHOMO 8 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------332----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 58.6 SQ:SECSTR ##################################################cccccccccHHHHHHHHHHHHHHHHHHHTcccEEEEEEEcccEEEEEEEEccccc####ccTTcccHHHHHHHHHHTTcEEEEEccc#cEEEEE######## DISOP:02AL 107-115, 151-152| PSIPRED cccccccccccccccccccHHHEEEEccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEEEEccccEEEEEEEcccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEcccccc //