[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68874.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->166 3cexA PDBj 4e-21 38.0 %
:RPS:PDB   15->166 3e4xA PDBj 2e-13 12.2 %
:RPS:SCOP  2->163 1rxqA  a.213.1.1 * 2e-16 14.7 %
:HMM:SCOP  1->166 1rxqA_ a.213.1.1 * 6e-14 28.0 %
:RPS:PFM   13->163 PF04978 * DUF664 2e-15 41.3 %
:HMM:PFM   8->166 PF04978 * DUF664 4.2e-19 23.4 145/150  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68874.1 GT:GENE BAC68874.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1454314..1454829 GB:FROM 1454314 GB:TO 1454829 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68874.1 LENGTH 171 SQ:AASEQ MHAKDVLTDAYSRIQEEVHAAVEGLAPDVLNARPADDANSISWLVWHLTRVQDDHLADASGLDQVWPAQGWDKRFGLDLPRRDTGYGHSPRQVAKVRVDSGELLLGYYDAVHEQSLEFIRGLTAKDLERVVDERWTPAVTLGARLVSVLADDLQHVGQAAYVRGLLQSAAS GT:EXON 1|1-171:0| BL:PDB:NREP 1 BL:PDB:REP 23->166|3cexA|4e-21|38.0|142/165| RP:PDB:NREP 1 RP:PDB:REP 15->166|3e4xA|2e-13|12.2|123/149| RP:PFM:NREP 1 RP:PFM:REP 13->163|PF04978|2e-15|41.3|138/148|DUF664| HM:PFM:NREP 1 HM:PFM:REP 8->166|PF04978|4.2e-19|23.4|145/150|DUF664| RP:SCP:NREP 1 RP:SCP:REP 2->163|1rxqA|2e-16|14.7|150/174|a.213.1.1| HM:SCP:REP 1->166|1rxqA_|6e-14|28.0|150/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ----1-------1-11111-11--1111111111111-11-1-1111--11--111------1-111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1----------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 93.6 SQ:SECSTR ######HHHHHHHHHHHHHHHHHTccGGGTTccccTTTccHHHHHHHHHHHHHHHHHHHHTcGGGGGccccccHHccccccccccccccHHHHGGcccccccccHHHHHHHHHHHHHHHHHTcTTGGGcEEEEHHHHcEEEHHHHHHHHHHHHHHHHHHHHHHHHT##### DISOP:02AL 1-4, 169-171| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //