[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68876.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  92/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->130 2a4wB PDBj 2e-13 23.0 %
:RPS:SCOP  2->131 1twuA  d.32.1.8 * 8e-14 14.2 %
:HMM:SCOP  1->135 1qipA_ d.32.1.1 * 3.4e-26 35.6 %
:RPS:PFM   3->111 PF00903 * Glyoxalase 2e-04 32.0 %
:HMM:PFM   4->124 PF00903 * Glyoxalase 1.2e-17 26.7 120/128  
:BLT:SWISS 4->127 Y3691_SHEFN 4e-24 52.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68876.1 GT:GENE BAC68876.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1455900..1456307) GB:FROM 1455900 GB:TO 1456307 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68876.1 LENGTH 135 SQ:AASEQ MRRIALVTLVVDDYDEAIRFYTEALGFRLAEDESRPDGSRWVVVEPGSAAAGTGLLLARAKGDAQRGRIGDQTGGRVGFFLHTDDFARDHARMRAAGVAFLEEPRYEPYGAVAVFQDLYGNRWDLLQPAPAPTAH GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 4->127|Y3691_SHEFN|4e-24|52.0|123/135| SEG 47->60|gsaaagtglllara| RP:PDB:NREP 1 RP:PDB:REP 3->130|2a4wB|2e-13|23.0|126/130| RP:PFM:NREP 1 RP:PFM:REP 3->111|PF00903|2e-04|32.0|103/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 4->124|PF00903|1.2e-17|26.7|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->131|1twuA|8e-14|14.2|127/137|d.32.1.8| HM:SCP:REP 1->135|1qipA_|3.4e-26|35.6|135/0|d.32.1.1|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 106 OP:NHOMOORG 94 OP:PATTERN -----------------------1-------------------------------------------- -11-----------------------------1---1-11--------------------11-----111-----------------------------------1-1-------------------------------------------------------------------------------------------------------------1-------------1---------------------------------------------11---------------------------------------------1------111-11---------1-----------------1-----------111----------------------------------------1--211111111111--1---1------11-------------------------------------------------------------------------------1--------------1------------1-------------------------------------------------------------------------11-1----1---111111-1111-1-1111--------------------------------------------------------1--------------------------------------------------------1------------------------------------------------------112143233111--1111111111-------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 100.0 SQ:SECSTR cccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEEEcGGGcEEEEEEHHHHTTTcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTcEEEEEEEEETTTEEEEEEcTTccEEEEEEEccTcEEc DISOP:02AL 131-135| PSIPRED ccEEEEEEEEcccHHHHHHHHHHHcccEEEEEccccccEEEEEEEcccccccEEEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEccEEcccEEEEEEEcccccEEEEEEcccccccc //