[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68878.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->76 2k4bA PDBj 4e-04 30.6 %
:RPS:PDB   44->73 1bibA PDBj 7e-04 20.0 %
:RPS:SCOP  13->118 2g9wA1  a.4.5.39 * 9e-06 26.4 %
:HMM:SCOP  8->124 1sd4A_ a.4.5.39 * 2.2e-14 35.3 %
:RPS:PFM   12->119 PF03965 * Pencillinase_R 1e-08 38.9 %
:HMM:PFM   12->119 PF03965 * Pencillinase_R 1.6e-27 41.1 107/115  
:BLT:SWISS 12->106 BLAI_MYCTU 3e-07 36.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68878.1 GT:GENE BAC68878.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1457398..1457769) GB:FROM 1457398 GB:TO 1457769 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03965: Penicillinase repressor GB:PROTEIN_ID BAC68878.1 LENGTH 123 SQ:AASEQ MAEAKDERRPAGELEATVMAALWAAGVPRTPGQVQLGLGAGLARTTVTTILSRLHEKGIVGRERHGRGYAYFPVQDAPGLTARRMHTELDRDSDRHTALARFVAQLSEDDERVLRDLLESGEQ GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 12->106|BLAI_MYCTU|3e-07|36.8|95/100| SEG 36->43|lglgagla| BL:PDB:NREP 1 BL:PDB:REP 15->76|2k4bA|4e-04|30.6|62/69| RP:PDB:NREP 1 RP:PDB:REP 44->73|1bibA|7e-04|20.0|30/294| RP:PFM:NREP 1 RP:PFM:REP 12->119|PF03965|1e-08|38.9|108/115|Pencillinase_R| HM:PFM:NREP 1 HM:PFM:REP 12->119|PF03965|1.6e-27|41.1|107/115|Pencillinase_R| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF03965|IPR005650| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF03965|IPR005650| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF03965|IPR005650| RP:SCP:NREP 1 RP:SCP:REP 13->118|2g9wA1|9e-06|26.4|106/119|a.4.5.39| HM:SCP:REP 8->124|1sd4A_|2.2e-14|35.3|116/0|a.4.5.39|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 29 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----3---------1----------------1-----1-1-312-----111111--1------11122-2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 50.4 SQ:SECSTR ##############ccHHHHHHHHHccEEHHHHHTccGGGcccHHHHHHHHHHHHHTTcccEEETTTEEEcccccc############################################### DISOP:02AL 1-11, 120-123| PSIPRED ccccccHHccccHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHccccHHHHccccEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHcc //