[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68884.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 31->166 RECA_LACSS 9e-05 23.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68884.1 GT:GENE BAC68884.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1464641..1465246 GB:FROM 1464641 GB:TO 1465246 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68884.1 LENGTH 201 SQ:AASEQ MTTPRDLLIVAMDVGSSRYVEPGDLSLALAGAEVIDLLGAGALTLEGDRIVSNNQWTLGDRLLDEAASSLVRQPPHEPVEDWLWRRGRGLSQAYLAALETEGQVARQPGRWLPVRTGRTALVDSPARRHAADRWASGEPVLAVLAAAAGIHDLPTEDSPSIADEAVVTVLAAVNDAVMELEAVRQRRSIEEAAFDNIWRGP GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 31->166|RECA_LACSS|9e-05|23.1|134/100| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------212----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 100-114| PSIPRED ccccccEEEEEEEccccccccccccEEEEHHHHHHHHHcccEEEEcccEEEcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHcccccHHcccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //