[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68885.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:263 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   63->242 3cswA PDBj 7e-22 19.1 %
:RPS:SCOP  119->242 1et0A  e.17.1.1 * 2e-20 15.3 %
:HMM:SCOP  33->255 1et0A_ e.17.1.1 * 2.9e-31 30.0 %
:RPS:PFM   142->237 PF01063 * Aminotran_4 2e-06 33.3 %
:HMM:PFM   45->240 PF01063 * Aminotran_4 4e-25 23.2 194/232  
:BLT:SWISS 139->240 ILVE_METJA 5e-06 28.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68885.1 GT:GENE BAC68885.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1465703..1466494) GB:FROM 1465703 GB:TO 1466494 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68885.1 LENGTH 263 SQ:AASEQ MTQPAIAEGLLAWNPDSGLTRGLAADTRLLAADSWLLRDGLVRGFDRHRERFRRACAECGAPPLDQLTAFWREMTAVLPRAGTWFPRVELVRGSLQLRLLLRHAPPLATEVRVWAAGQPDPRTVPRRKGPDLDALGRVRLRAGGQGAEEAVLITPSGVVLEAANSSILWWEDDTLCMPPPQLPVLAGVTVGLVQERALRTGIRLAHRERTPAELAGREVWLVNALHGIRPVVEWTGRPMNAGFAVRAPEWREWLDGILEPLPD GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 139->240|ILVE_METJA|5e-06|28.4|102/288| SEG 43->60|rgfdrhrerfrracaecg| SEG 90->102|lvrgslqlrlllr| RP:PDB:NREP 1 RP:PDB:REP 63->242|3cswA|7e-22|19.1|178/272| RP:PFM:NREP 1 RP:PFM:REP 142->237|PF01063|2e-06|33.3|96/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 45->240|PF01063|4e-25|23.2|194/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 119->242|1et0A|2e-20|15.3|124/254|e.17.1.1| HM:SCP:REP 33->255|1et0A_|2.9e-31|30.0|220/266|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----1111111------------------------------------1-111--------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 75.3 SQ:SECSTR #############################################################ccHHHHHHHHHHHHTTccccEEEEEEEcTTTccEEEEEEEccccccTTcEEEEEcEcccccccTTTccTTcccTTcHHHHTTcccccEEEEEcTTccEEEEcccEEEEEETTEEEEEcGGGTccccHHHHHHHHHHHHTTccEEEEcccHHHHHTccEEEEETTTEEEEEEEETTEEccccccHHHHHHHHHHHTTcc#### DISOP:02AL 1-3| PSIPRED cccccHHcccEEEccccccccccccccHHHHHHHHHHHccEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHccccEEEEEcccccEEEEcccEEEEEEccEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEccHHHHHHcEEEEEccccccEEEEEEccEEEccccccccHHHHHHHHHHHHcccc //