[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68892.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   43->84 PF06282 * DUF1036 3e-08 47.5 %
:HMM:PFM   43->119 PF06282 * DUF1036 1.8e-07 25.7 74/115  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68892.1 GT:GENE BAC68892.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1473954..1474355 GB:FROM 1473954 GB:TO 1474355 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68892.1 LENGTH 133 SQ:AASEQ MAARSPASTRLQDKGGAMSLNLKNNYHQPVWAMVEWHHPNCSDGGDWMKKGWWKIGPGQTSTVFGDDVHAVNPIWYCYAHSSDGLEWRDRFQELVPTHAFEWCSNTADTSSRTILMNEFVVSRPNHVHTFLAP GT:EXON 1|1-133:0| RP:PFM:NREP 1 RP:PFM:REP 43->84|PF06282|3e-08|47.5|40/111|DUF1036| HM:PFM:NREP 1 HM:PFM:REP 43->119|PF06282|1.8e-07|25.7|74/115|DUF1036| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13| PSIPRED cccccccccEEEccccEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEEEEccccccEEEcccccccccEEEEEEEccccEEEcccHHHHHHHHHccccccccccccEEEEHHHHHHcccccEEEEEcc //