[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68893.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  225/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.61.6
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->175 1wubA PDBj 3e-16 32.1 %
:RPS:SCOP  35->176 1wubA  b.61.6.1 * 1e-31 31.9 %
:HMM:SCOP  31->195 1y0gA_ b.61.6.1 * 8.3e-34 34.6 %
:RPS:PFM   80->171 PF04264 * YceI 1e-16 47.8 %
:HMM:PFM   35->185 PF04264 * YceI 9.2e-35 32.4 142/159  
:BLT:SWISS 80->147 Y3941_PSEU5 7e-13 42.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68893.1 GT:GENE BAC68893.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1474359..1474949) GB:FROM 1474359 GB:TO 1474949 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04264: YceI like family GB:PROTEIN_ID BAC68893.1 LENGTH 196 SQ:AASEQ MDDMVVVRPRHPLPGSLHFPVRRTLMTLAVETGLWQLDRTASTVAVRHKTMWGLVTVKGAFTSISGQGEVEPDGTAHGTITLEAASLDTKNAKRDTHLRSADFFDVENHPEITFAVRTAEAGPGDTVQVAGQLTVRGISRPQSFTARVTRADSDAITLAAEFTADRDQFGMGWNQLSMMRGLTTVTATLRLTRAAA GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 80->147|Y3941_PSEU5|7e-13|42.6|68/191| SEG 180->195|rglttvtatlrltraa| BL:PDB:NREP 1 BL:PDB:REP 35->175|1wubA|3e-16|32.1|140/176| RP:PFM:NREP 1 RP:PFM:REP 80->171|PF04264|1e-16|47.8|92/161|YceI| HM:PFM:NREP 1 HM:PFM:REP 35->185|PF04264|9.2e-35|32.4|142/159|YceI| RP:SCP:NREP 1 RP:SCP:REP 35->176|1wubA|1e-31|31.9|141/176|b.61.6.1| HM:SCP:REP 31->195|1y0gA_|8.3e-34|34.6|162/0|b.61.6.1|1/1|YceI-like| OP:NHOMO 272 OP:NHOMOORG 228 OP:PATTERN --------------------------------------------------------------11---- 1211211----111111----1--12-----11111212112112211-1--132111----2-1213421----------------------------1-1--13-3-2------------------1-----1-11111----1----------------------------------------11---1--------------------------1111111111111-111111111111111111111--------------------------------------------------------------------------------------------------1---------------------2-1---1-----1-----------------------------11---1--11---1-----1-----------1----------------11--------------------------------11-------------------11--------1------------------------------------------31----111------222-1---2334431--1----------1-1111111-1---11----1------1-----------1-------------------11---1-1111111111-111111111111-111111---111111111111111111111-1111111----------------------------1--1-------------------------1-1111----1----1----------------------11-------------1111---------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 71.9 SQ:SECSTR ##################################EEEcGGGcEEEEEEEETcTTEEEEEEEEEEEEEEEEcTTccEEEEEEEEEEEEEcccHHHHHHHHcTTTTcTTTccEEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEcccEEcEEEEEEEEEEEGGGGTccccc##################### DISOP:02AL 1-2, 195-196| PSIPRED cccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEEccEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEccHHHHHHHHccccHHHHHcccEEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcccccHHHcccccEEEEEEEEEEEEcc //