[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68894.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->141 3f3xA PDBj 9e-05 30.7 %
:RPS:PDB   25->156 3bpxB PDBj 9e-14 12.5 %
:RPS:SCOP  29->156 3broA1  a.4.5.28 * 8e-14 12.7 %
:HMM:SCOP  21->162 1jgsA_ a.4.5.28 * 4.4e-23 33.3 %
:RPS:PFM   53->111 PF01047 * MarR 6e-04 35.1 %
:HMM:PFM   53->113 PF01047 * MarR 5.3e-09 25.4 59/59  
:BLT:SWISS 53->156 HOSA_ECOLX 4e-06 26.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68894.1 GT:GENE BAC68894.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1475033..1475533 GB:FROM 1475033 GB:TO 1475533 GB:DIRECTION + GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC68894.1 LENGTH 166 SQ:AASEQ MAEPSAPADLPEHVQTPQDGLLPAELRAWMLLLAATGAIEQQLRAVVKDALGISHDEFLVLCLLADQPGSGLRMTRIAELLGRPKTRLTYQVACLQHAGLVTRQSVCGDKRGVQVTLTDKARRALSEASVPMADAVSEALARTIGPAQREAMYGLLPTDSCPPDDA GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 53->156|HOSA_ECOLX|4e-06|26.7|101/135| BL:PDB:NREP 1 BL:PDB:REP 51->141|3f3xA|9e-05|30.7|88/139| RP:PDB:NREP 1 RP:PDB:REP 25->156|3bpxB|9e-14|12.5|128/138| RP:PFM:NREP 1 RP:PFM:REP 53->111|PF01047|6e-04|35.1|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 53->113|PF01047|5.3e-09|25.4|59/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 29->156|3broA1|8e-14|12.7|126/135|a.4.5.28| HM:SCP:REP 21->162|1jgsA_|4.4e-23|33.3|138/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 32 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----1-1-111----------------------1113112-1-111----------1-----1-41-311---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 87.3 SQ:SECSTR ###############TTcccHHHHcccHHHHHHHHHHHHHHHHHHHHGGHGTccHHHHHHHHHHHHcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHH###### DISOP:02AL 1-15, 163-166| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc //