[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68895.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->101 2fyiC PDBj 6e-05 31.2 %
:RPS:PDB   1->126 1bi3A PDBj 8e-07 16.1 %
:RPS:SCOP  11->195 1i69A  c.94.1.1 * 1e-12 16.2 %
:HMM:SCOP  2->201 1al3A_ c.94.1.1 * 1.1e-19 25.1 %
:RPS:PFM   30->109 PF03466 * LysR_substrate 9e-05 39.5 %
:HMM:PFM   22->195 PF03466 * LysR_substrate 5.4e-26 27.6 174/209  
:BLT:SWISS 24->202 ALSR_BACSU 2e-07 23.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68895.1 GT:GENE BAC68895.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1475897..1476667) GB:FROM 1475897 GB:TO 1476667 GB:DIRECTION - GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF03466: LysR substrate binding domain GB:PROTEIN_ID BAC68895.1 LENGTH 256 SQ:AASEQ MTGSEVTPSFRLAYVPGVTPAKWVRIWNERLPDIPLTLIPVPAAEASDLLRDGGADAGFVRLPTDRTDLSAIPLYAETTVVVVPKDHLVAAVDEVSAEDLADDIVLHPLDDTLDWEHLPGRPAIERPATTADAVELVAAGVGLLLVPQSLARLHHRRDLTYRTVTDAPESRVALSWREDETTDLVEDFIGIVRGRTANSSRGRSQTPPEPKASKAKRSDASGARRKPAAGKTTGKSTRSGGGGAKPGKRGKPRRRS GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 24->202|ALSR_BACSU|2e-07|23.5|179/302| SEG 131->146|adavelvaagvglllv| SEG 229->255|agkttgkstrsggggakpgkrgkprrr| BL:PDB:NREP 1 BL:PDB:REP 24->101|2fyiC|6e-05|31.2|77/228| RP:PDB:NREP 1 RP:PDB:REP 1->126|1bi3A|8e-07|16.1|124/211| RP:PFM:NREP 1 RP:PFM:REP 30->109|PF03466|9e-05|39.5|76/207|LysR_substrate| HM:PFM:NREP 1 HM:PFM:REP 22->195|PF03466|5.4e-26|27.6|174/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 11->195|1i69A|1e-12|16.2|185/206|c.94.1.1| HM:SCP:REP 2->201|1al3A_|1.1e-19|25.1|199/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 37 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----2--111111-1------1----------11111121---1-11-1111111--1----1---1121--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 87.9 SQ:SECSTR TTcccHHHHHHHHHHTTTccHHHHHHHHHccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccETcEEETTEEEEccHHHHHHcEEEcEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEETTcccHHHHHHHHHHcTTccHHHHHHHHHcccHHHHHHHHHHcccccc############################### DISOP:02AL 1-6, 196-256| PSIPRED ccccccccEEEEEEHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEcccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEEcHHHHHHHHHccccEEEEEHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //