[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68896.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->59 PF04046 * PSP 0.00098 43.5 23/48  
:HMM:PFM   82->130 PF03280 * Lipase_chap 0.0008 26.5 49/195  
:REPEAT 2|11->55|62->105

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68896.1 GT:GENE BAC68896.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1476726..1477133 GB:FROM 1476726 GB:TO 1477133 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68896.1 LENGTH 135 SQ:AASEQ MTSHQTTQTMKPATAAKKLGVYLEATPAEFQEGVVSRSELNALQADPPEWLQELRRNGPHPRPVVAAKLGVSIAGLARGGVTDALTTEQIDALKQDQPEWLRKERATQAEVRKESARIKEQQEQKAKDAARGDRR GT:EXON 1|1-135:0| NREPEAT 1 REPEAT 2|11->55|62->105| HM:PFM:NREP 2 HM:PFM:REP 37->59|PF04046|0.00098|43.5|23/48|PSP| HM:PFM:REP 82->130|PF03280|0.0008|26.5|49/195|Lipase_chap| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----11111111111------1----------11111111-----1--1111111-----------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 108-135| PSIPRED ccccHHHHHHHHHHHHHHccccccccHHHHccccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //