[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68906.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->125 1s7iA PDBj 9e-13 37.3 %
:RPS:SCOP  32->126 1mwqA  d.58.4.7 * 1e-07 19.2 %
:HMM:SCOP  9->132 1s7iA_ d.58.4.9 * 1.2e-26 40.7 %
:RPS:PFM   76->124 PF03795 * YCII 1e-05 40.8 %
:HMM:PFM   15->124 PF03795 * YCII 2.6e-14 32.6 89/95  
:BLT:SWISS 36->125 Y369_RHIME 3e-07 36.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68906.1 GT:GENE BAC68906.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1486716..1487108) GB:FROM 1486716 GB:TO 1487108 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04946: DGPF domain GB:PROTEIN_ID BAC68906.1 LENGTH 130 SQ:AASEQ MKDHPVGDHRGGHIMKHYLLSVMQPAGEPPAPEVLEGIMHNLDVFHAELREAGAWVFAGGLHGPETATVLRAEEGGDVLITDGPYTESKEYLGGICLIKAPDLDAALEWGRKATLATTLPIEVRPFMGEA GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 36->125|Y369_RHIME|3e-07|36.0|89/100| BL:PDB:NREP 1 BL:PDB:REP 15->125|1s7iA|9e-13|37.3|110/124| RP:PFM:NREP 1 RP:PFM:REP 76->124|PF03795|1e-05|40.8|49/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 15->124|PF03795|2.6e-14|32.6|89/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 32->126|1mwqA|1e-07|19.2|78/100|d.58.4.7| HM:SCP:REP 9->132|1s7iA_|1.2e-26|40.7|123/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 66 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -11-2---------2------------------2221122-----6-1------1--1---12---21-1------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1-112-----------------1-----------------1--11--3---41-222----1----------1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 84.6 SQ:SECSTR ##############EEEEEEEEEcGGGcccccHHHHHHHHHHHHHHHHHHHHTcEEEEEEcccGGGcEEEE#EccccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTcGGGGGcEEEEEE##### DISOP:02AL 1-4, 6-7, 27-32| PSIPRED cccccccccccHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccEEEEEEccccEEEEEccccccccccccEEEEEcccHHHHHHHHHHccccccccEEEEEEcccc //