Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68913.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68913.1 GT:GENE BAC68913.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1493561..1493815) GB:FROM 1493561 GB:TO 1493815 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68913.1 LENGTH 84 SQ:AASEQ MSITGWRAREFSSLFADLGEGLDDLGVPEGQPFLISPAGVYDVALNRYFSVWLAFAVEHPGRPCPGPAHVLRLPVVRARQAGLA GT:EXON 1|1-84:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 83-84| PSIPRED cccccccHHHHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccHHHHHccccc //