[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68914.2
DDBJ      :             putative IS630 family ISPsy1-like transposase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1c.55.3
:389 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  28->162 1pdnC_ a.4.1.5 * 2.7e-12 26.0 %
:HMM:SCOP  220->363 1c6vA_ c.55.3.2 * 4.6e-06 16.1 %
:HMM:PFM   235->327 PF00665 * rve 6.5e-11 15.1 93/120  
:HMM:PFM   49->206 PF04909 * Amidohydro_2 1.5e-05 21.1 114/270  
:BLT:SWISS 30->334 YIS5_SHISO 4e-14 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68914.2 GT:GENE BAC68914.2 GT:PRODUCT putative IS630 family ISPsy1-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1493973..1495142) GB:FROM 1493973 GB:TO 1495142 GB:DIRECTION - GB:PRODUCT putative IS630 family ISPsy1-like transposase GB:NOTE IS3 family (1495177..1493942) Inverted repeat sequence (27/29 bp). Target sequence (CTAG). GB:PROTEIN_ID BAC68914.2 LENGTH 389 SQ:AASEQ MAVACGVTSDPTAGGAVAEPVRVRRLTDHEGQKLQQIVHRGSTSSVRYRRAMMLLASAGGKRVPVIAQLVQADEDTVRDVIHAFNEKGLACLDPRWAGGRPRQLKSDEEDFVVQTATTCPVKLGQPFTRWSLRKLVAYLRKVHGRVIRIGREALRCLLARRGVTFQRTKTWKESPDPERETKLDRIEHVLDRFPDRVFAFDEFGPLGIRPIGGSCWAEQTRPDRLPATYHRTHGVRYFHGCYSVGDDRLWGVNRRKKGSGNTLAALKSIRAARPDGAPIYVILDNLSAHKGADIRRWAKKHKVELCFTPTYASWANPIEAHFGPLRQFTIANSHHPNHTVQTRALHSYLRWRNANARHCDVLAAERKERARIRSEKGTRWGGRPLTTAA GT:EXON 1|1-389:0| BL:SWS:NREP 1 BL:SWS:REP 30->334|YIS5_SHISO|4e-14|24.2|298/100| HM:PFM:NREP 2 HM:PFM:REP 235->327|PF00665|6.5e-11|15.1|93/120|rve| HM:PFM:REP 49->206|PF04909|1.5e-05|21.1|114/270|Amidohydro_2| HM:SCP:REP 28->162|1pdnC_|2.7e-12|26.0|123/0|a.4.1.5|1/1|Homeodomain-like| HM:SCP:REP 220->363|1c6vA_|4.6e-06|16.1|137/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 257 OP:NHOMOORG 65 OP:PATTERN ---------------------------------------------------------------1---- ----1-----1--------------9----------2-81-15F----------------61--2-B344------------4---------------------------------------------------------------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------1------C----------------------------4-16--------------------1----------1--2---1--5-----------------------------------------------------------------------1-----------33-1-1-----21------------I---1-1B-----------------------------------------1--1--------2----------------------------X4-1-----------------1-2--1-----------------21------------------1--------------------D--3--1-----1-1--1-11-2--L--------------------------------------------------------------------------1---------------------------------1-------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 35-45, 93-102, 386-389| PSIPRED ccEEcccccccccccccccccHHEEccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHccccccccHHccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccEEEEcccccccEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccEEccccc //