[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68919.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  713/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:306 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->240 3fzvB PDBj 5e-17 29.1 %
:RPS:PDB   1->211 1bi3A PDBj 2e-20 12.7 %
:RPS:SCOP  1->96 1b9mA1  a.4.5.8 * 7e-16 11.5 %
:RPS:SCOP  88->297 1i69A  c.94.1.1 * 4e-19 20.9 %
:HMM:SCOP  1->111 1b9mA1 a.4.5.8 * 8.6e-24 32.4 %
:HMM:SCOP  84->295 2esnA2 c.94.1.1 * 3.3e-29 23.9 %
:RPS:PFM   5->61 PF00126 * HTH_1 3e-06 49.1 %
:RPS:PFM   92->263 PF03466 * LysR_substrate 6e-05 31.3 %
:HMM:PFM   88->291 PF03466 * LysR_substrate 4.5e-35 28.8 198/209  
:HMM:PFM   4->62 PF00126 * HTH_1 4.1e-21 47.5 59/60  
:BLT:SWISS 1->250 YVBU_BACSU 5e-21 27.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68919.1 GT:GENE BAC68919.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1499955..1500875 GB:FROM 1499955 GB:TO 1500875 GB:DIRECTION + GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF03466: LysR substrate binding domain GB:PROTEIN_ID BAC68919.1 LENGTH 306 SQ:AASEQ MRTEQLEYIAAVTRLGSLRRAAEELHLSQPALSETVRNLERELGVDLLERKRSGARMSAEGRELLPHIINVLDAVDRLRGAAGEQHRISRMVRLGTVNAATVPLLIPVVREFRAAHPLTQVEVVGAQQSEIHRSLLEGGFDLGLVNHLDGDDVAADFETTELLRGRPVVCVRPDSPLASRTTVSVSDLLAEPLIAMRSGYVMHRFVHRLLEGHSPSFSYSTDGAEMGKLMVAEGLGATVLPDFSVIDDPLERRGAITYRPLADDSTQVLLMLQRRRAESVPQAAQGLYETFVGRAEALGGTLTGRP GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->250|YVBU_BACSU|5e-21|27.3|242/292| BL:PDB:NREP 1 BL:PDB:REP 5->240|3fzvB|5e-17|29.1|220/284| RP:PDB:NREP 1 RP:PDB:REP 1->211|1bi3A|2e-20|12.7|204/211| RP:PFM:NREP 2 RP:PFM:REP 5->61|PF00126|3e-06|49.1|57/60|HTH_1| RP:PFM:REP 92->263|PF03466|6e-05|31.3|166/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 88->291|PF03466|4.5e-35|28.8|198/209|LysR_substrate| HM:PFM:REP 4->62|PF00126|4.1e-21|47.5|59/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->96|1b9mA1|7e-16|11.5|96/122|a.4.5.8| RP:SCP:REP 88->297|1i69A|4e-19|20.9|201/206|c.94.1.1| HM:SCP:REP 1->111|1b9mA1|8.6e-24|32.4|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->295|2esnA2|3.3e-29|23.9|209/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 5431 OP:NHOMOORG 720 OP:PATTERN -----------------------1-----------------------------1-------------- 366-F--233321185511-15113J11111266766ENS-4161112111-7572-6--323-84MCE941333111-37A411---2221-111---113-12312-3---------------1--------1-45534---214336223122211111133276562111111-1111122------62B7777799848778976476CC87B2418131333533KV-111111-11111113---61224454-211AB2265242-2322212222222332222222222222122122212222223331112-12692222223222-5661---431-15142-KK44121262111---32118221-----25EDI437785544454445544F-AAC88N8GCJ4-PHHE7F6OOJFEKH4228DJ867A6FI43444444A8A65333------------------------------17I31DqbQddhhokgGGGGFaankLKKLCH*Tofjng-1PLFBAHFCkDV7fG9G34221A61122212-3457722-12231125333-1-2335-2-34255813-------------------------55D674669353674444225556373933571--2229------GACC6DADGGCDCBCEC-GCCDFC9DFCGCFBBCCBBKRJBC576GAGAHIHHIGGDHDAGI9A9999C4-644545434555--11111114434258EN2222232223223339989969153H4UUTULYNaERRRO7FGK21111111115779777776576689DDFEB66522221-3222------------1-------------------------------------161 -------------3------------------------------------------------------------------------------------------------------------------------------------------------8----------------1------------8-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 97.4 SQ:SECSTR HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEccEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHTTTccHHHHHHHHHHcEccccccTTccccTTHHHHTcccEEHHHHccTcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEEEEccHHHHHHcEEEHHcccccEEEcHHHHHHHHHHHcTTEEEEEEHHHHHTcTTTcEEcEEEcTTccEEcccHHHHHHHTTTccTTTcccccccccccTTH######## DISOP:02AL 81-89, 297-306| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEcccccHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccc //