[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68920.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:49 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->24 PF06773 * Bim_N 3.9e-05 57.9 19/41  
:REPEAT 2|8->17|39->48
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68920.1 GT:GENE BAC68920.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1500906..1501055 GB:FROM 1500906 GB:TO 1501055 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68920.1 LENGTH 49 SQ:AASEQ MRRAARDPTRRPNAMRRAAPVSLSWARGGARPLGPGRQPTRRPGTATRP GT:EXON 1|1-49:0| NREPEAT 1 REPEAT 2|8->17|39->48| SEG 26->37|arggarplgpgr| HM:PFM:NREP 1 HM:PFM:REP 4->24|PF06773|3.9e-05|57.9|19/41|Bim_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 34-49| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccc //