[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68928.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->179 2hyjA PDBj 1e-30 42.4 %
:RPS:PDB   13->173 3bqzA PDBj 6e-16 11.5 %
:RPS:SCOP  2->75 1rktA1  a.4.1.9 * 1e-08 21.6 %
:RPS:SCOP  84->173 2hyjA2  a.121.1.1 * 4e-13 43.3 %
:HMM:SCOP  1->89 1t33A1 a.4.1.9 * 2.2e-15 30.7 %
:HMM:SCOP  83->198 2i10A2 a.121.1.1 * 3.9e-17 23.3 %
:HMM:PFM   17->63 PF00440 * TetR_N 2.5e-11 34.0 47/47  
:BLT:SWISS 4->56 TTGW_PSEPU 1e-05 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68928.1 GT:GENE BAC68928.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1510755..1511354 GB:FROM 1510755 GB:TO 1511354 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68928.1 LENGTH 199 SQ:AASEQ MSPRKSVAEAAATRDRIIERAFTLASAEGLEGLTIGRLATDLGMSKAGVIGHFGTKEALQLAVLEAAVDRFRQRVPGRAVGARPGTERLSRALHEWIDYMTESEGHGGCFLTSVASEFDGRPGPVRDAVLDALSRWTAYVTGELSTAVEAGRLPPLTDVDQLAFELNGVILAADQSIQLHRDPQAPDRARRAIGRLLKR GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 4->56|TTGW_PSEPU|1e-05|37.7|53/134| SEG 57->68|ealqlavleaav| SEG 181->192|rdpqapdrarra| BL:PDB:NREP 1 BL:PDB:REP 8->179|2hyjA|1e-30|42.4|172/193| RP:PDB:NREP 1 RP:PDB:REP 13->173|3bqzA|6e-16|11.5|157/186| HM:PFM:NREP 1 HM:PFM:REP 17->63|PF00440|2.5e-11|34.0|47/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 2->75|1rktA1|1e-08|21.6|74/81|a.4.1.9| RP:SCP:REP 84->173|2hyjA2|4e-13|43.3|90/118|a.121.1.1| HM:SCP:REP 1->89|1t33A1|2.2e-15|30.7|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 83->198|2i10A2|3.9e-17|23.3|116/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 90 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- ----1------------11-1---------------1--1-1---1----------------1----111--------------------------------------------------------------------------1-1--1----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------11---1----------------------------------1-------------------------------------222-1111111111111111111111112222--22111111112121----------------------------------------------1111-1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 89.9 SQ:SECSTR #HHHHHTccGGGHHHHHHHHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHHHTTTcTTHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHH################### DISOP:02AL 1-16| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc //