[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68929.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   91->131 PF03779 * SPW 5e-05 36.6 %
:HMM:PFM   37->87 PF03779 * SPW 1.1e-21 48.0 50/51  
:HMM:PFM   92->141 PF03779 * SPW 4e-22 44.0 50/51  
:BLT:SWISS 85->143 UPPP_XANOR 3e-04 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68929.1 GT:GENE BAC68929.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1511493..1511933 GB:FROM 1511493 GB:TO 1511933 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:NOTE PF03779: SPW repeat GB:PROTEIN_ID BAC68929.1 LENGTH 146 SQ:AASEQ MANVSHTRGDIASHPDVPEMRERYARMLGGRDVVLVDGPVFLLGLYCAASPWILHYTTSQPALATHNLIMGIAIGLLALGFTSTPERMYGLSWAMCAIGAWMIISPWIVGTSPDTGVVLNSIIIGVLTVVLGALCAVTTTRNTPRT GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 85->143|UPPP_XANOR|3e-04|28.8|59/265| TM:NTM 4 TM:REGION 31->53| TM:REGION 61->82| TM:REGION 88->110| TM:REGION 118->139| SEG 68->80|limgiaigllalg| RP:PFM:NREP 1 RP:PFM:REP 91->131|PF03779|5e-05|36.6|41/50|SPW| HM:PFM:NREP 2 HM:PFM:REP 37->87|PF03779|1.1e-21|48.0|50/51|SPW| HM:PFM:REP 92->141|PF03779|4e-22|44.0|50/51|SPW| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----1-----------1---------------------11--------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 142-146| PSIPRED cccccccccccccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccc //