[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68931.1
DDBJ      :             putative amino acid permease
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  328/915 : Eukaryota  82/199 : Viruses  0/175   --->[See Alignment]
:489 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->329 3gi9C PDBj 2e-08 26.4 %
:RPS:PFM   201->425 PF00324 * AA_permease 2e-12 29.5 %
:HMM:PFM   24->419 PF00324 * AA_permease 1.3e-30 19.4 392/479  
:BLT:SWISS 72->434 AAA1_RAT 3e-19 26.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68931.1 GT:GENE BAC68931.1 GT:PRODUCT putative amino acid permease GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1513650..1515119) GB:FROM 1513650 GB:TO 1515119 GB:DIRECTION - GB:PRODUCT putative amino acid permease GB:NOTE PF00324: Amino acid permease GB:PROTEIN_ID BAC68931.1 LENGTH 489 SQ:AASEQ MSGSPGSPPPEGGFVRRVGLFQATTINMSQMCGIGPFVTIPLMVAAFGGPQAVIGFVAGAVLALADGLVWAELGAAMPGSGGSYVYLRQAFQYRTGRLMPFLFVWTAMLFIPLIMSTGVVGFVQYLGYLAPDMGRTTGDLVGVGIIALVVMLLWRGIENIARITAVMWTVMIASVLLVIVAAASDFSAHLAFTYPAHAFEPTSGHFWVGFAAGLTIGIYDYLGYNTTAYMGAEIKDPGRTLPRSILFSILGIMAIYLLLQIGTLGVIDWHRMTDAGDIASTSVASAVLEKTWGKGAADTVTVLILITAFASVFTGLLGGSRVPYDAARDRVFFRPYAKLHSRHRFPMLGLATMGVITAIGFLIGRHTDLATLIQLLTTVMVIVQALAQIVALTVLRKRQPTLRRPYRMWLYPLPSVIALVGWLVIYGYADKNSPGRHPIEWSLAWVALGCVAFVVWARLEKVWPFGPREIAEEYLTAAAPDADAEPAQT GT:EXON 1|1-489:0| BL:SWS:NREP 1 BL:SWS:REP 72->434|AAA1_RAT|3e-19|26.4|337/530| TM:NTM 12 TM:REGION 18->40| TM:REGION 43->65| TM:REGION 101->123| TM:REGION 137->159| TM:REGION 164->186| TM:REGION 202->224| TM:REGION 245->267| TM:REGION 298->320| TM:REGION 346->368| TM:REGION 372->394| TM:REGION 409->431| TM:REGION 439->461| SEG 2->13|sgspgspppegg| SEG 52->71|avigfvagavlaladglvwa| SEG 170->184|vmiasvllvivaaas| SEG 477->487|aaapdadaepa| BL:PDB:NREP 1 BL:PDB:REP 72->329|3gi9C|2e-08|26.4|242/437| RP:PFM:NREP 1 RP:PFM:REP 201->425|PF00324|2e-12|29.5|217/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 24->419|PF00324|1.3e-30|19.4|392/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 729 OP:NHOMOORG 420 OP:PATTERN ----------------2-------1---1--------------1---1--111---------2----1 488-1---------211----1--24-----2-333--32-1--11-------22-------1-125422-1---111----1---11---1-------3-12--4-3-2------------------------------------1-------------------311---------------------11121111131-1111221-11134-212121-2--11111--2111111-11111111---112311112233222211131132111---1111--------------------------1-----------11--2323333-2--211-211------2111---------1---1---4---11------12-11--------------------11111-1---1------1----11---------------222222221--11-------------------------------------------122121-111111--1221-11--23----1-------1--1--------211---------------------1-------------11----1---------------------------------1--1------------------------------------11---1-2221211122-2222111212211222221242-1-2-1-1111111111111112211112--322122222222----21221-------12---------------2222111-----2212121-1252---11------------------------1122122112--------111111-------------------------------------1--------11- --------------1221--1111-11-------------------11-11-----------1------1-------------------13-2122-------321----95213311----3145111121-11-----5-222131112111213247BM246216228--42--------------1----1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 49.7 SQ:SECSTR #######################################################################HHTTTcccTTTHHHHHHHHHcHHHHHHH##HHHHHHHHHHHHHHHHHHHHH##HTTTccccccHHHHHHHHHHHHHHHHHHTTTTHHHHHH##HHHHHHHHHHHHHHHHHHHHTTcccHHHHcccccHHHHHHHHHHH#####HHTTGGGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHTcTTHHHHHTHHHH####cHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHH################################################################################################################################################################ DISOP:02AL 1-19, 485-489| PSIPRED cccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccc //