[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68935.1
DDBJ      :             putative transglycosylase associated protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->58 PF10762 * DUF2583 0.00028 34.7 49/89  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68935.1 GT:GENE BAC68935.1 GT:PRODUCT putative transglycosylase associated protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1521090..1521353 GB:FROM 1521090 GB:TO 1521353 GB:DIRECTION + GB:PRODUCT putative transglycosylase associated protein GB:NOTE PF04226: Transglycosylase associated protein GB:PROTEIN_ID BAC68935.1 LENGTH 87 SQ:AASEQ MEISGIISAIVIGIVIGILGRLVVPGRQRIGILLTILVGIVAALIGSAIAGAFDVADTNGVDWIEWLIQIGLAALGVAALDRTRARR GT:EXON 1|1-87:0| TM:NTM 3 TM:REGION 3->25| TM:REGION 32->54| TM:REGION 60->81| SEG 3->24|isgiisaivigivigilgrlvv| SEG 30->45|igilltilvgivaali| HM:PFM:NREP 1 HM:PFM:REP 10->58|PF10762|0.00028|34.7|49/89|DUF2583| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 83-87| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //