[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68938.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->136 1pw4A_ f.38.1.1 * 1.8e-11 31.6 %
:HMM:PFM   2->133 PF07690 * MFS_1 2.3e-13 27.8 126/353  
:BLT:SWISS 2->101 SOTB_HELPG 2e-04 25.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68938.1 GT:GENE BAC68938.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1523648..1524178 GB:FROM 1523648 GB:TO 1524178 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE possible transporter GB:PROTEIN_ID BAC68938.1 LENGTH 176 SQ:AASEQ MVFGVATVAGIWTVGALIDAHLRRTLLCALALIGATLLALGRYADRPAVLLISVALWGAAFGGAPTLIQTALVDASGPADADVATSLQTTVYNAGIAGGSLTGGLVLDGAGAGALPWTALPLVAAALTVVALGRRRGFPALRPSDDARSSGQGPSPARGCTPRSGNSRSPRPPPVS GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 2->101|SOTB_HELPG|2e-04|25.3|99/391| TM:NTM 4 TM:REGION 1->22| TM:REGION 25->47| TM:REGION 54->76| TM:REGION 104->126| SEG 26->40|llcalaligatllal| SEG 103->132|gglvldgagagalpwtalplvaaaltvval| SEG 162->174|prsgnsrsprppp| HM:PFM:NREP 1 HM:PFM:REP 2->133|PF07690|2.3e-13|27.8|126/353|MFS_1| HM:SCP:REP 1->136|1pw4A_|1.8e-11|31.6|136/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----------1-----1------------------------------------------------------------------------------------------------------1----1-------------------------------------------------------11------------------------------------------------------------------------------------1-------11-------------------------------------------1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 141-176| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc //