Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68950.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68950.1 GT:GENE BAC68950.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1540024..1540284 GB:FROM 1540024 GB:TO 1540284 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68950.1 LENGTH 86 SQ:AASEQ MVGDRVAGPSARDASRPAVMRSRAGCPKPQGRLPEPVMPQTASHRIGGEQRAEPVRIPGVGQVPMRGEQFGDRRGSSKPGARRILL GT:EXON 1|1-86:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 20-30, 44-48, 67-80| PSIPRED cccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccc //