[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->74 PF04149 * DUF397 7e-07 49.0 %
:HMM:PFM   20->73 PF04149 * DUF397 4.2e-17 41.3 46/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68951.1 GT:GENE BAC68951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1540468..1540710) GB:FROM 1540468 GB:TO 1540710 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE homology to bldB, PF04149: Domain of unknown function (DUF397) GB:PROTEIN_ID BAC68951.1 LENGTH 80 SQ:AASEQ MAESTIKEHPLAGWDKPELDLSKAEWQSSSRGRGDVQIAFVEGFIAMRNSGRPESPSLIFTPAEWGAFVSGAREGEFDLT GT:EXON 1|1-80:0| RP:PFM:NREP 1 RP:PFM:REP 24->74|PF04149|7e-07|49.0|51/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 20->73|PF04149|4.2e-17|41.3|46/56|DUF397| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------2----------------11--1-112------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccccccccccccccccccEEEcccccccEEEEEcccccEEccccccccccEEEEcHHHHHHHHHHHHccccccc //