[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68954.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:306 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   166->230 2gnrA PDBj 4e-06 29.2 %
:RPS:SCOP  154->281 2gnrA1  b.40.4.15 * 2e-14 20.2 %
:RPS:PFM   179->209 PF12172 * DUF35_N 3e-06 54.8 %
:RPS:PFM   216->279 PF01796 * DUF35 8e-05 37.5 %
:HMM:PFM   54->117 PF01796 * DUF35 2.1e-12 30.6 62/68  
:HMM:PFM   216->280 PF01796 * DUF35 3.8e-12 35.9 64/68  
:HMM:PFM   179->211 PF12172 * DUF35_N 3.3e-11 54.5 33/37  
:BLT:SWISS 187->279 Y1552_METJA 7e-11 37.4 %
:PROS 95->105|PS00639|THIOL_PROTEASE_HIS
:REPEAT 2|3->117|164->279
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68954.1 GT:GENE BAC68954.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1543003..1543923) GB:FROM 1543003 GB:TO 1543923 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01796: Domain of unknown function DUF35 GB:PROTEIN_ID BAC68954.1 LENGTH 306 SQ:AASEQ MEFPFTRSLGPVQSAFLTGLRERVLLGVKTGDGRTLVPPVEYDPVTAEEIHDLVEVAPTGTVTTWAWNHAPRRGQPLDTPFAWVLVRLDGADTALLHALDAAGPDAVHSGLRVRVRWAAQRSGAITDIACFEPYDSGDDAAAEPTGHDGRFADPVTGIVAPARLDYVYSPGRAQSAHLDALAEQRTVGERCPSCRKVYVPPRGACPTCGVATSEAVEVGPRGTVTTYCIVNIKAKNLDIEVPYVYAHIALDGADLALHGRIGGIPYDQVRMGLRVEPVWTDGGRHPDHYRPTGEPDADYETYKELL GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 187->279|Y1552_METJA|7e-11|37.4|91/141| PROS 95->105|PS00639|THIOL_PROTEASE_HIS|PDOC00126| NREPEAT 1 REPEAT 2|3->117|164->279| SEG 88->102|ldgadtallhaldaa| BL:PDB:NREP 1 BL:PDB:REP 166->230|2gnrA|4e-06|29.2|65/136| RP:PFM:NREP 2 RP:PFM:REP 179->209|PF12172|3e-06|54.8|31/36|DUF35_N| RP:PFM:REP 216->279|PF01796|8e-05|37.5|64/66|DUF35| HM:PFM:NREP 3 HM:PFM:REP 54->117|PF01796|2.1e-12|30.6|62/68|DUF35| HM:PFM:REP 216->280|PF01796|3.8e-12|35.9|64/68|DUF35| HM:PFM:REP 179->211|PF12172|3.3e-11|54.5|33/37|DUF35_N| RP:SCP:NREP 1 RP:SCP:REP 154->281|2gnrA1|2e-14|20.2|124/137|b.40.4.15| OP:NHOMO 54 OP:NHOMOORG 45 OP:PATTERN ------1-11111111--1----4-----------11------------------------------- ----1---------31111-11--1111111111111121-1------------------111----1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------4------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 21.2 SQ:SECSTR #####################################################################################################################################################################HHHHcHHHHHHHHHHHHTTccEEEEcTTTccEEEccccEETTTTEEccEEEEccGGcEEEEEEEE############################################################################ DISOP:02AL 300-301| PSIPRED cEEcEEccccHHHHHHHHHHHcccEEEEEcccccEEEcccccccccccccccEEEccccEEEEEEEEEEcccccccccccEEEEEEEEcccccEEEEEEEcccHHHcccccEEEEEEccccccEEccEEEEEEEcccccccccccccccEEcccccEEEEcccEEEEccccHHHHHHHHHHHcccEEEEEEccccEEEEccHHcccccccccccEEEEcccEEEEEEEEEEcccccccccccEEEEEEEEccccEEEEEEEEcccHHHcccccEEEEEEEEcccccccccccccccccHHHHHHcc //