[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68958.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  164/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.110.2
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->178 3dbaA PDBj 7e-11 9.2 %
:RPS:SCOP  7->178 1f5mA  d.110.2.1 * 4e-11 17.1 %
:HMM:SCOP  30->196 1mc0A2 d.110.2.1 * 2.5e-16 24.3 %
:RPS:PFM   87->174 PF01590 * GAF 3e-05 31.0 %
:HMM:PFM   31->178 PF01590 * GAF 1.1e-25 25.6 117/154  
:BLT:SWISS 98->239 YEAP_ECOLI 5e-06 26.9 %
:PROS 167->183|PS00815|AIPM_HOMOCIT_SYNTH_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68958.1 GT:GENE BAC68958.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1547571..1548623) GB:FROM 1547571 GB:TO 1548623 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01590: GAF domain GB:PROTEIN_ID BAC68958.1 LENGTH 350 SQ:AASEQ MDPLSSSDPARLASEQRRLRLQVLGLNTVEAEATFDRIARLAASFTQSPLAMVNFINDERQMFRGMYVPSGSPDDKVSPESGGIAFDLSNLSREAPGDYGFCPHVVAQGSQLALDDVFDYPRFKGNPLVNDLGVRSYLGTPLRDNTGMILGTVCVADMKPRTWDRGLREGMQELTETLLSDFKLRDSLLAQQQELFAVFDGAPFPIMLTEGPDHLLRYANGKQGSAFGLVPQFSPGRHVLPGLEAIGVFGAMDDAFHTGQAATLARASIQTYDSHTLQDFNFLCTPVRTSPAAPISGVLTVAMNTTGQDFAGSEQRAFAANVQERFERLGAGGLPGGMPGQRAESAGYRG GT:EXON 1|1-350:0| BL:SWS:NREP 1 BL:SWS:REP 98->239|YEAP_ECOLI|5e-06|26.9|130/341| PROS 167->183|PS00815|AIPM_HOMOCIT_SYNTH_1|PDOC00643| SEG 329->340|lgagglpggmpg| RP:PDB:NREP 1 RP:PDB:REP 11->178|3dbaA|7e-11|9.2|163/171| RP:PFM:NREP 1 RP:PFM:REP 87->174|PF01590|3e-05|31.0|87/143|GAF| HM:PFM:NREP 1 HM:PFM:REP 31->178|PF01590|1.1e-25|25.6|117/154|GAF| RP:SCP:NREP 1 RP:SCP:REP 7->178|1f5mA|4e-11|17.1|164/176|d.110.2.1| HM:SCP:REP 30->196|1mc0A2|2.5e-16|24.3|152/0|d.110.2.1|1/1|GAF domain-like| OP:NHOMO 283 OP:NHOMOORG 176 OP:PATTERN -----------------------------1-1------------------------------------ 121-2----------------2----------2111-------1-----1----1-------2-1--223-------------------------------1-1--2-21--------------------------1-------1--2-1---11111111-12211335-1--1111-11-121---------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------1-1-11---------112--11211------------54442246-2-----1----------2-1---2122-1---------1-------------------------------------2-11---------1--2------11------111------11--11112----------211----------------1------------1-1----------1------------------------------11-21-----11211111---11----1-------2--------111-2-------------------------------21211--------------------------------------------------1111---2----------------------1-----2-1212121---11222----------------------11--67676323--------11-1--------------------------------------------------- ------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1--11--------------112123- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 48.0 SQ:SECSTR ##########cHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHTEEEEEEEEEEEETTEEEEEEEEccEEEEEcTTccHHHHcccGGGccEEcTTccHHHHHHHHTccEEEccGGGcTTcccHHHHHccccccEEEEEEEEETTEEEEEEEEEEEccccccHHHHHHHHHHHHHH############################################################################################################################################################################ DISOP:02AL 1-5, 314-324, 343-350| PSIPRED cccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHccccEEEEEcHHHcHHHccccccccccEEEEEEEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEccHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHccccccccccccccEEEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //