[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68972.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->115 2b7sA PDBj 2e-06 14.6 %
:RPS:SCOP  11->75 1d4cA2  c.3.1.4 * 2e-05 26.2 %
:HMM:SCOP  27->81 2gmhA1 c.3.1.2 * 2e-05 40.0 %
:HMM:PFM   24->95 PF01494 * FAD_binding_3 1.4e-09 31.0 71/356  
:BLT:SWISS 27->79 GGR_PYRFU 4e-04 43.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68972.1 GT:GENE BAC68972.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1567506..1568018 GB:FROM 1567506 GB:TO 1568018 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68972.1 LENGTH 170 SQ:AASEQ MSIFVVPTGDVPQMAHRDGHEPSFTPWRRTGVTGLLEDDSGRVTGVRYVDEHGSPGELAADLTVACDGRDSSVRRAAGLEPSYFEVPMDVWQVRVPARDPLKEGRVSLTVRDGQFAATLDRGDYYQTSYLIKKGTDGALRPMASSGSATGSASCSAGTVRRRTPSAPGTT GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 27->79|GGR_PYRFU|4e-04|43.1|51/393| SEG 143->158|assgsatgsascsagt| RP:PDB:NREP 1 RP:PDB:REP 27->115|2b7sA|2e-06|14.6|89/568| HM:PFM:NREP 1 HM:PFM:REP 24->95|PF01494|1.4e-09|31.0|71/356|FAD_binding_3| RP:SCP:NREP 1 RP:SCP:REP 11->75|1d4cA2|2e-05|26.2|65/322|c.3.1.4| HM:SCP:REP 27->81|2gmhA1|2e-05|40.0|55/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 50 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- --------------31111-11--311111111----------1---------11-1---1---2131--1-----------1-----------------------------------------------------------------------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111------------------------1--1--11---------1--------------------------------------------------------------1---------------------------------------------------11------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 62.4 SQ:SECSTR ##########HHHHHHHHHHHTTcEEEccEEEEEEEEcTTccEEEEEEEETTTEEEEEEccEEEEcccccTTcHHHHHHHcGGGTTccccccTTcccHHHHHHHHTTccEEcTTcE###################################################### DISOP:02AL 161-170| PSIPRED cEEEEEccHHHHHHHHHHHHccccEEEEccEEEEEEEccccEEEEEEEEcccccEEEEEEEEEEEEEccccHHHHHHccccccccccEEEEEEEcccccccccccEEEEEccccEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHccccccccccEEcccccccccc //