[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68978.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->62 PF03860 * DUF326 1.1e-07 40.0 20/23  
:HMM:PFM   126->145 PF03860 * DUF326 1.1e-07 45.0 20/23  
:REPEAT 2|49->60|134->145
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68978.1 GT:GENE BAC68978.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1575577..1576035) GB:FROM 1575577 GB:TO 1576035 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03860: Domain of Unknown Function (DUF326) GB:PROTEIN_ID BAC68978.1 LENGTH 152 SQ:AASEQ MTSTTSRRTARAASRIPSRTTPGTPPDPFPDGASPQELFRFLEDRFTCAQACTECARACALRASFAGPDGPEGQELVRRKGIMCAEVCDATCRVLSEQARQDEETLRIQLEWCRTVCLECAHVFDDHPGAENSAKACRECAQACADFMATLV GT:EXON 1|1-152:0| NREPEAT 1 REPEAT 2|49->60|134->145| SEG 2->32|tsttsrrtaraasripsrttpgtppdpfpdg| HM:PFM:NREP 2 HM:PFM:REP 43->62|PF03860|1.1e-07|40.0|20/23|DUF326| HM:PFM:REP 126->145|PF03860|1.1e-07|45.0|20/23|DUF326| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------1--------------11------------------------------------------------------------------------------------------------------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23| PSIPRED ccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHc //