[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68981.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1a.4.1b.45.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   110->207 3fkhE PDBj 5e-08 34.4 %
:RPS:PDB   2->93 2ao9A PDBj 3e-06 5.4 %
:RPS:PDB   83->206 3cp3A PDBj 1e-13 31.9 %
:RPS:SCOP  2->93 2ao9A1  a.4.1.17 * 1e-06 5.4 %
:RPS:SCOP  82->205 2hq9A1  b.45.1.1 * 5e-22 29.4 %
:HMM:SCOP  1->66 2bnmA1 a.35.1.3 * 5.7e-10 36.4 %
:HMM:SCOP  78->207 2hq9A1 b.45.1.1 * 2.3e-23 33.6 %
:HMM:PFM   7->57 PF01381 * HTH_3 9e-10 32.0 50/55  
:HMM:PFM   85->169 PF01243 * Pyridox_oxidase 1.9e-08 26.8 82/89  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68981.1 GT:GENE BAC68981.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1577424..1578050) GB:FROM 1577424 GB:TO 1578050 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC68981.1 LENGTH 208 SQ:AASEQ MGRRITQRREELGLTREETAGRAGTDPGYLQYLEEQATALPSTNVLIRLADALETTVVALRGGDADLPPGVGRAAAHPELLELSDEECRARLSTHGVGRLAVDTPTGPVIVPLNYSVVDGVVCFRTAADSEPAASAGSRVAFEVDHIDEALSQGWSVLVRGLARLVTDPDTLRRLAELAYSGPWAGGERDTWVCVDPVGVTGRRIVVR GT:EXON 1|1-208:0| SEG 8->19|rreelgltreet| BL:PDB:NREP 1 BL:PDB:REP 110->207|3fkhE|5e-08|34.4|90/124| RP:PDB:NREP 2 RP:PDB:REP 2->93|2ao9A|3e-06|5.4|92/117| RP:PDB:REP 83->206|3cp3A|1e-13|31.9|119/127| HM:PFM:NREP 2 HM:PFM:REP 7->57|PF01381|9e-10|32.0|50/55|HTH_3| HM:PFM:REP 85->169|PF01243|1.9e-08|26.8|82/89|Pyridox_oxidase| RP:SCP:NREP 2 RP:SCP:REP 2->93|2ao9A1|1e-06|5.4|92/117|a.4.1.17| RP:SCP:REP 82->205|2hq9A1|5e-22|29.4|119/134|b.45.1.1| HM:SCP:REP 1->66|2bnmA1|5.7e-10|36.4|66/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 78->207|2hq9A1|2.3e-23|33.6|128/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 51 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------1-1211-11--3211111222221----111-------1153-------31-1-12-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHcccccccHHHHHHHHTccHHHHHHHHHHcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHccccGGGccccHHHEcHHHHHHHHHTccEEEEEEEETTEEEEEEEEEEEEcccccEEEEEEcccccTcccEEEEEEEEcccccTTEEEEEEEEEEEEcccHHHHHHHTTcccTccccTTcccEEEEEEEEEEEEEEEccE DISOP:02AL 1-2, 64-82| PSIPRED ccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccccccccccEEccHHHHHHHHHccccEEEEEEcccccEEEEEEEEEEccEEEEEEcccccHHHHccccEEEEEEEEEcccccccEEEEEEcEEEcccHHHHHHHHHHccccccccccccEEEEEEEEEEEcEEEEEc //