[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68988.1
DDBJ      :             putative CRP-like regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.3
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->133 3i54A PDBj 4e-07 29.1 %
:RPS:PDB   32->145 3d0sA PDBj 8e-14 21.9 %
:RPS:SCOP  32->155 1cx4A2  b.82.3.2 * 6e-14 17.2 %
:HMM:SCOP  24->154 1ne6A2 b.82.3.2 * 4.3e-16 19.1 %
:HMM:PFM   51->138 PF00027 * cNMP_binding 2.7e-14 18.2 88/91  
:HMM:PFM   6->74 PF10667 * DUF2486 0.00082 17.4 69/246  
:BLT:SWISS 1->101 KGP1B_HUMAN 4e-04 28.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68988.1 GT:GENE BAC68988.1 GT:PRODUCT putative CRP-like regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1587146..1587679 GB:FROM 1587146 GB:TO 1587679 GB:DIRECTION + GB:PRODUCT putative CRP-like regulatory protein GB:NOTE PF00027: Cyclic nucleotide-binding domain GB:PROTEIN_ID BAC68988.1 LENGTH 177 SQ:AASEQ MARAGTQEHAGSGRSVPTSWRPVMNAPPTSSMLRALPSEHRQQLMRVALEVSFPEGTRLFEEGARADRFWVIRTGAIDLDMHVPGRKAVVIETLRHNELVGWSWLFAPHTWHLGAETTTPVRAYEFDAVAVRAMCQEDSALGLAVAHWVGEILAHRLRSTRTRLLDLHAPYGSGSRH GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 1->101|KGP1B_HUMAN|4e-04|28.9|90/686| SEG 156->167|rlrstrtrlldl| BL:PDB:NREP 1 BL:PDB:REP 48->133|3i54A|4e-07|29.1|86/224| RP:PDB:NREP 1 RP:PDB:REP 32->145|3d0sA|8e-14|21.9|114/224| HM:PFM:NREP 2 HM:PFM:REP 51->138|PF00027|2.7e-14|18.2|88/91|cNMP_binding| HM:PFM:REP 6->74|PF10667|0.00082|17.4|69/246|DUF2486| RP:SCP:NREP 1 RP:SCP:REP 32->155|1cx4A2|6e-14|17.2|122/139|b.82.3.2| HM:SCP:REP 24->154|1ne6A2|4.3e-16|19.1|131/0|b.82.3.2|1/1|cAMP-binding domain-like| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------1-1------------------------13--------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 70.6 SQ:SECSTR ##############################GTTccccccTTHHHHTTccEEEEcTTcEEEcTTccccEEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccHHHHcccccccEEEEcccEEEEEEEHHHHHHTTcccHHHHHHHHHHHHHHHHH###################### DISOP:02AL 1-8, 169-177| PSIPRED ccccHHHHHHcccccccccccEEEcccccccccccccHHHHHHHHHHHHHcccccccEEEEccccccEEEEEEEcEEEEEEEcccccEEHEEEccccccEEHHHHcccccccEEEEEEccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //