[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68992.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  751/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->209 1a04A PDBj 1e-25 34.9 %
:RPS:PDB   7->216 3c3wB PDBj 2e-31 31.9 %
:RPS:SCOP  8->122 1p2fA2  c.23.1.1 * 1e-19 26.1 %
:RPS:SCOP  152->217 1a04A1  a.4.6.2 * 3e-17 40.9 %
:HMM:SCOP  1->136 1k66A_ c.23.1.1 * 2.9e-29 38.2 %
:HMM:SCOP  135->221 1p4wA_ a.4.6.2 * 3.5e-19 42.5 %
:RPS:PFM   9->120 PF00072 * Response_reg 7e-14 41.8 %
:RPS:PFM   156->206 PF00196 * GerE 2e-09 54.9 %
:HMM:PFM   9->115 PF00072 * Response_reg 1.9e-27 40.6 106/112  
:HMM:PFM   155->211 PF00196 * GerE 6.8e-20 47.4 57/58  
:BLT:SWISS 7->215 DEGU_BACSU 5e-33 39.7 %
:PROS 171->198|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68992.1 GT:GENE BAC68992.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1590871..1591551) GB:FROM 1590871 GB:TO 1591551 GB:DIRECTION - GB:PRODUCT putative two-component system response regulator GB:NOTE PF00072: Response regulator receiver domain GB:PROTEIN_ID BAC68992.1 LENGTH 226 SQ:AASEQ MSGACVIRVLVVDDEALIRTGFQHILDTADDIEVVAAVPGGQALQTAQEIRPDVVLLDIRMPDVDGLTLLACLRRLPHPPVVAMLTTFDMDEYVATALRSGAAGFLLKDTDPEGLPFLVRTLADGGTVLASKVTRTVVDGYLNAGPQEPAARSLAALTDRERAVLVLIAEGLSNADIGTRMHLSTGTVKDHVSAILTKLKVDGRVQAALLAERAGLLKPPRDQEGE GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 7->215|DEGU_BACSU|5e-33|39.7|209/229| PROS 171->198|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 9->209|1a04A|1e-25|34.9|192/205| RP:PDB:NREP 1 RP:PDB:REP 7->216|3c3wB|2e-31|31.9|207/210| RP:PFM:NREP 2 RP:PFM:REP 9->120|PF00072|7e-14|41.8|110/111|Response_reg| RP:PFM:REP 156->206|PF00196|2e-09|54.9|51/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 9->115|PF00072|1.9e-27|40.6|106/112|Response_reg| HM:PFM:REP 155->211|PF00196|6.8e-20|47.4|57/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 8->122|1p2fA2|1e-19|26.1|111/120|c.23.1.1| RP:SCP:REP 152->217|1a04A1|3e-17|40.9|66/67|a.4.6.2| HM:SCP:REP 1->136|1k66A_|2.9e-29|38.2|136/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 135->221|1p4wA_|3.5e-19|42.5|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 4953 OP:NHOMOORG 779 OP:PATTERN -----------------------2-------1---2--1222113-3512424-2-2121-------- DHJ4p85644433576622-29115G222223EBBBFKHJ9FAaJSC86ECA798768--9BH7bEQemeD3444B4413329--2-111-1--11---3-7133J5H64--------------1----1----2-HJKHK779I8F8ADAA54334121134765FEHI2122122221222676321328AB99999BCB6B99BBACGCC9CACC7978A43343333Nb444434434444444344531-1-22-1--1221222221-1-111122232333344444444444111111211111153433333327A68A3333443232C22222229281-F1164C9969657673146222E424334-----15K8D3277889B22222222222-BDAAEBDA294-64445464657853413633444534411111111-1112B69------------------------------2174156554878A95C8765CCBG9AAB5B9CACFKE12CEAFD7778ACGF5694BB5C94111111112599A18B925851A8555197E7BDG4557C6AA751-------------------22--1--982B87857328AAAA696ACC4887849A---5536------85685857886765677-8777767777867777776555665649789999899899999777666762-988888788888--3344444111124A5611111211111-112332333322276FFGGBFBFCA9A99B99---------23556677776B577DDEDGDBBAD33331131553322--------3---------------------------11122121213U- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------2-----------3--1---1-4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 100.0 SQ:SECSTR ccccTTEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHETHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTcTcccccTTTT DISOP:02AL 1-4, 138-155, 217-226| PSIPRED ccccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccc //