[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68994.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   54->194 2dwpA PDBj 2e-17 25.0 %
:RPS:SCOP  42->198 1bifA2  c.60.1.4 * 5e-14 21.8 %
:HMM:SCOP  4->203 1k6mA2 c.60.1.4 * 7.9e-30 30.2 %
:RPS:PFM   50->145 PF00300 * PGAM 1e-09 35.4 %
:HMM:PFM   25->144 PF00300 * PGAM 1.2e-15 30.8 120/158  
:HMM:PFM   4->23 PF03458 * UPF0126 0.00072 35.0 20/81  
:BLT:SWISS 64->163 COBC_SALTY 1e-07 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68994.1 GT:GENE BAC68994.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1593064..1593717 GB:FROM 1593064 GB:TO 1593717 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00300: Phosphoglycerate mutase family GB:PROTEIN_ID BAC68994.1 LENGTH 217 SQ:AASEQ MTVRLTFMCATAGGTTRDAVFGDGLLSERGLRRARAAGATLPPYSLAIRAPSVRCAQTAYALGLPTTLEPALRDLDYGTWRGRTVGEVVADEPYGYSAWLTDPDAAPHGGESVRRLCRRIANWLSSVPPYPGRALVITEPSVVRASLVHALSAPVTAFRHFDVPPLSTVSLTLSDGHWIVRPGRVTPDRVGTSRAVPTPYDAAEGRTALLWGEATPA GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 64->163|COBC_SALTY|1e-07|25.0|100/202| SEG 24->41|gllserglrraraagatl| RP:PDB:NREP 1 RP:PDB:REP 54->194|2dwpA|2e-17|25.0|140/431| RP:PFM:NREP 1 RP:PFM:REP 50->145|PF00300|1e-09|35.4|96/158|PGAM| HM:PFM:NREP 2 HM:PFM:REP 25->144|PF00300|1.2e-15|30.8|120/158|PGAM| HM:PFM:REP 4->23|PF03458|0.00072|35.0|20/81|UPF0126| RP:SCP:NREP 1 RP:SCP:REP 42->198|1bifA2|5e-14|21.8|156/219|c.60.1.4| HM:SCP:REP 4->203|1k6mA2|7.9e-30|30.2|199/219|c.60.1.4|1/1|Phosphoglycerate mutase-like| OP:NHOMO 73 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- -------1111111-22----1--11-----111111----221--------1---------1----422------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11------------------------1--1---11-111-11--1-----------------------1-------------------------------------------1111112------11------1-1---------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1111-1111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 76.0 SQ:SECSTR #########################################ccccEEEEcccHHHHHHHHTTTccEEEcGGGcccccGGGTTccHHHHHHHcHHHHHHHHTcTTcccTTcccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHTTccTTTGGGccccTTEEEEEEEETTEEEEEEEEccccccccccccccGccHHHHT########### DISOP:02AL 212-213, 215-217| PSIPRED ccEEEEEEEccccHHHHHcccccccccHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccEEcHHHHHccccHHccccHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcccHHHHHcccccccEEEEEEEEcccEEEEEccccccccccccccccccccccccccccccccccc //