[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68999.1
DDBJ      :             putative sugar hydrolase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  35/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.1.2
:343 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->135 1x5gA PDBj 5e-07 37.6 %
:BLT:PDB   146->186 1k85A PDBj 2e-05 41.5 %
:RPS:PDB   52->143 2e3vA PDBj 2e-11 23.3 %
:RPS:PDB   263->339 2aewB PDBj 3e-06 21.7 %
:RPS:SCOP  52->140 1x3dA1  b.1.2.1 * 4e-11 22.7 %
:RPS:SCOP  263->340 1fg9C1  b.1.2.1 * 4e-06 7.6 %
:HMM:SCOP  51->142 1wk0A_ b.1.2.1 * 2.6e-16 43.8 %
:HMM:SCOP  146->236 1k85A_ b.1.2.1 * 5.4e-13 30.7 %
:HMM:SCOP  242->340 1f6fB2 b.1.2.1 * 1.2e-07 29.2 %
:HMM:PFM   53->129 PF00041 * fn3 1.2e-14 39.5 76/85  
:HMM:PFM   151->221 PF00041 * fn3 1e-11 31.0 71/85  
:HMM:PFM   259->283 PF00041 * fn3 6.9e-05 44.0 25/85  
:BLT:SWISS 53->186 CHIA1_BACCI 1e-15 32.6 %
:BLT:SWISS 254->342 PRLR_MELGA 7e-04 29.5 %
:REPEAT 2|52->117|152->214
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68999.1 GT:GENE BAC68999.1 GT:PRODUCT putative sugar hydrolase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1597420..1598451 GB:FROM 1597420 GB:TO 1598451 GB:DIRECTION + GB:PRODUCT putative sugar hydrolase GB:NOTE PF00041: Fibronectin type III domain GB:PROTEIN_ID BAC68999.1 LENGTH 343 SQ:AASEQ MAYRYRPIPSREGGPVRRLVRRLRVPVICGSLFLTVSCGWGGQDGGRDGPLPSAPMGVTAAAGSATSVHVMWNQVSGGPKVAGYEVYRGTTKVKDVPGAEHMVDITRLKPSTTYVFTVRARDDAGNAGLPSAKVRATTPAAVAADHRAPTRPGRPSGKAVGSRAAQLNWARSTDDRGVASYDIYQGTSKIHSVGGGQTATVVTGLRPGTRYSFTVRARDAADNVSAASASVRLTTAGGADDGRGTAPTRFRAGTHRADGAYYIDLSWSPPDTDGVITEYQIHLDGRPATSLVWGGKPPRGKATYSFYLGRDAGARHRVRIRAKLPDGTWGGFSDERTVTTGGR GT:EXON 1|1-343:0| BL:SWS:NREP 2 BL:SWS:REP 53->186|CHIA1_BACCI|1e-15|32.6|132/699| BL:SWS:REP 254->342|PRLR_MELGA|7e-04|29.5|88/831| NREPEAT 1 REPEAT 2|52->117|152->214| SEG 15->27|pvrrlvrrlrvpv| SEG 39->49|gwggqdggrdg| SEG 193->204|vgggqtatvvtg| SEG 215->232|vrardaadnvsaasasvr| SEG 234->248|ttaggaddgrgtapt| BL:PDB:NREP 2 BL:PDB:REP 51->135|1x5gA|5e-07|37.6|85/116| BL:PDB:REP 146->186|1k85A|2e-05|41.5|41/88| RP:PDB:NREP 2 RP:PDB:REP 52->143|2e3vA|2e-11|23.3|90/102| RP:PDB:REP 263->339|2aewB|3e-06|21.7|74/188| HM:PFM:NREP 3 HM:PFM:REP 53->129|PF00041|1.2e-14|39.5|76/85|fn3| HM:PFM:REP 151->221|PF00041|1e-11|31.0|71/85|fn3| HM:PFM:REP 259->283|PF00041|6.9e-05|44.0|25/85|fn3| RP:SCP:NREP 2 RP:SCP:REP 52->140|1x3dA1|4e-11|22.7|88/105|b.1.2.1| RP:SCP:REP 263->340|1fg9C1|4e-06|7.6|77/98|b.1.2.1| HM:SCP:REP 51->142|1wk0A_|2.6e-16|43.8|89/0|b.1.2.1|1/3|Fibronectin type III| HM:SCP:REP 146->236|1k85A_|5.4e-13|30.7|88/88|b.1.2.1|2/3|Fibronectin type III| HM:SCP:REP 242->340|1f6fB2|1.2e-07|29.2|96/103|b.1.2.1|3/3|Fibronectin type III| OP:NHOMO 46 OP:NHOMOORG 37 OP:PATTERN -----------------------------1-------------------------------------- ---------------------------------------------1---------------------232--------------------------------------------------------------------------11------------------------------------------------11111111111112-------113---1----1111-22----------------------------------------------------------------------------------------------1----------1---------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 72.3 SQ:SECSTR #################################################ccccccEEEEEEEcccccEEEEEEcccccccEEEEEEEEEETTEEHHHHHTTEEEEccccTTcEEEEEEEEEETTEEcccccccEEEEccccccccTTcTTcccccccccTTcccccccccTTcccccEccEEEEEEEcTTccTTcEEEEEcEEEEEEEEEcccc############################################EcccEEEEEEcccccccEEEEEEEEEETTccccEEEEEEHHHHHTTEEEEcccTTcEEEEEEEEEETTEEEccccccEEEEcE## DISOP:02AL 14-15, 17-18, 42-54, 342-343| PSIPRED cEEEEEEEEEcccccccccEEEEEEcccccEEEEEEEEEEccccccccccccccccccEEEEEcccEEEEEEEccccccccEEEEEEEccEEEEEEcccEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEccccccccccccccccccEEEEccccEEEEEEEcccccccEEEEEEEEcccEEEEEccccEEEEEcccccccEEEEEEEEEEccccccccccEEEEEEccccccccccccccccccEEEEccccEEEEEEEcccccccEEEEEEEEEccccccEEEEEEEccccEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEEccc //