[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69000.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->108 PF00801 * PKD 2.3e-05 34.0 47/69  
:PROS 68->110|PS00041|HTH_ARAC_FAMILY_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69000.1 GT:GENE BAC69000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1598664..1599200 GB:FROM 1598664 GB:TO 1599200 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69000.1 LENGTH 178 SQ:AASEQ MRTIQLFSRSGLAVAAAALPLTLASPAAAAWNSGISVSTSGSNVSVATTTCTPFNGSLGNASLLSSGQANFTQGRLAMLTGSNISQSGVWSNVSPGTYTVVVVCANGSTAGTQSIIVSGSSTPTISATASPSRGVMGGVGGSVEHYGTITFAVGAALVAVGAVATGWYLRRRTKPYRL GT:EXON 1|1-178:0| PROS 68->110|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| TM:NTM 2 TM:REGION 8->30| TM:REGION 147->169| SEG 12->30|lavaaaalpltlaspaaaa| SEG 55->67|ngslgnasllssg| SEG 118->132|sgsstptisatasps| SEG 134->143|gvmggvggsv| SEG 152->164|avgaalvavgava| HM:PFM:NREP 1 HM:PFM:REP 17->108|PF00801|2.3e-05|34.0|47/69|PKD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 119-133, 176-178| PSIPRED ccccHHHHHccHHHHHHHHHHHHHccccccccccEEEEEcccEEEEEEEEEcccccccccHHHHHccHHHHHHcEEEEEEccccccccccccccccEEEEEEEEccccccccEEEEEEccccccccccccccccccccccccHHHcccEEHHHHHHHHHHHHHHHHHHHHHccccccc //