[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69008.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  183/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.176.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->193 1xdyG PDBj 6e-08 31.0 %
:RPS:PDB   7->201 2biiA PDBj 9e-34 19.6 %
:RPS:SCOP  19->199 1xdqA  d.176.1.1 * 4e-37 25.1 %
:HMM:SCOP  27->201 1ogpA2 d.176.1.1 * 1.3e-48 35.4 %
:RPS:PFM   33->182 PF00174 * Oxidored_molyb 4e-17 37.7 %
:HMM:PFM   37->183 PF00174 * Oxidored_molyb 1.3e-39 32.7 147/169  
:BLT:SWISS 45->192 Y1802_GLUOX 3e-12 36.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69008.1 GT:GENE BAC69008.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1606980..1607585 GB:FROM 1606980 GB:TO 1607585 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00174: Oxidoreductase molybdopterin binding domain GB:PROTEIN_ID BAC69008.1 LENGTH 201 SQ:AASEQ MNVTRGFTGRPRVHHPGLPPGQYDAGDDWPVLSAEVTPDLAAADWSFRIDGLVAEPRTWSWDAAHALAPSAYEGDIHCVTSWSKFGVRFGGVSLDAFLGLVRPDATATHAVAYSHTGYTTNLPLTDLTGGRAWIAWEYDGRPLPAEHGGPARLLVPHLYFWKSAKWIAGLRILDHDEPGFWEQNGYHARGNPWEEQRYSGD GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 45->192|Y1802_GLUOX|3e-12|36.8|144/312| BL:PDB:NREP 1 BL:PDB:REP 45->193|1xdyG|6e-08|31.0|145/261| RP:PDB:NREP 1 RP:PDB:REP 7->201|2biiA|9e-34|19.6|194/415| RP:PFM:NREP 1 RP:PFM:REP 33->182|PF00174|4e-17|37.7|146/156|Oxidored_molyb| HM:PFM:NREP 1 HM:PFM:REP 37->183|PF00174|1.3e-39|32.7|147/169|Oxidored_molyb| GO:PFM:NREP 1 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00174|IPR000572| RP:SCP:NREP 1 RP:SCP:REP 19->199|1xdqA|4e-37|25.1|179/262|d.176.1.1| HM:SCP:REP 27->201|1ogpA2|1.3e-48|35.4|175/261|d.176.1.1|1/1|Oxidoreductase molybdopterin-binding domain| OP:NHOMO 307 OP:NHOMOORG 227 OP:PATTERN 111-112122222222-21111111111-112-----------11----11----------111---- -1214---------1-1----1--12-----121111121-2-213---2--232--1--211-1-43311-----------211121-----------------1-1----------------------------1111111-112112111-------------12221------------21111---1-1-----------------11-1---111----------22----------------------------------------------------------------------------------------------------------------------------------------------1-----------2221--22122------------11211211----1---1111111112---1------111--------2331112---------------------------------21-1---211112111111--22111111112------211-----2-2-1--1-1-11-1-----------12------------------------223221---------------------------------------------11----------1----------------1-1-----1-11-----------------------------------------------2------------------------------------------------------------------1121--1-------111-----------------------------------------------------------------------------------------------1- -------------------------1-----------------------------------------------------------------------------------1--------------------------------------------------------------------12111---------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 98.0 SQ:SECSTR ####TTEEEcccHHHHHHHTcccccGGGccEEEcccccGGGGGGcEEEEEEcccccEEEEHHHHHHHcccEEEEEEEcTTTTHHHHEEEEEEEHHHHHHHHcccTTccEEEEEETcccEEEEEHHHHTcTTcEEEEEETTEEccGGGTTTcEEEcTTccGGGccccEEEEEEEccccccHHHHcccccccTTccHHHHHHc DISOP:02AL 201-202| PSIPRED cccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEEcccEEEEHHHHHHcccEEEEEEEEEEcccccccEEEccEEHHHHHHHccccccccEEEEEEcccccccEEHHHHccccEEEEEEEccEEccHHHcccEEEEcccccccccccEEEEEEEEEccccccHHHccccccccHHHccccccc //